Os06t0103500-01

Locus

Os06g0103500

Description

Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ACX1, OsACX1

Oryzabase Gene Name Synonym(s)

acyl-CoA oxidase 1

Transcript Evidence

AK060849 (DDBJ, Best hit)

AK100758 (DDBJ, Best hit)

Protein Evidence

E9L0E1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: fatty acid metabolic process (GO:0006631)

Biological Process: fatty acid beta-oxidation (GO:0006635)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Cellular Component: peroxisome (GO:0005777)

Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995)

Molecular Function: acyl-CoA oxidase activity (GO:0003997)

Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Functional domain (InterPro)

Acyl-CoA oxidase, C-terminal (IPR002655)

Acyl-CoA oxidase/dehydrogenase, central domain (IPR006091)

Acyl-CoA dehydrogenase/oxidase C-terminal (IPR009075)

Acyl-CoA dehydrogenase/oxidase (IPR009100)

Acyl-CoA oxidase (IPR012258)

Acyl-CoA dehydrogenase/oxidase, N-terminal (IPR013786)

Acyl-CoA oxidase, peroxisomal (IPR023570)

Full-length cDNA

001-034-E06 (Online Clone Ordering)

J023119B01 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0103500-01)

RiceXPro (AK060849)

Others

Oryzabase (22011)

KEGG (Os06t0103500-01 (EC:1.3.3.6))

Transcript

2445 bp

>Os06t0103500-01 Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).
AACTCCCAACTCCCAAGTTGCAATCGAGAATAAATAAAAATCCCAATCCCCTCCTTCTCT
TCTTCTTCCTCCCTGTTCCCTTTTCGATTCGATTGGATTGGATTGTTTTGCTGGCTCGCT
CTCTCTCTCTCTCTCGTGGTGTGGTGTGGACAAGAAAGGAAGGAAAGATGGAGGGCGGCG
TAGGGGGGGAGGTGGACCACCTCGCCGGCGAGAGGGCCACCGCGCAGTTCGACGTTGAAC
ACATGAAGGTTGCCTGGGCTGGCTCCCGCCACGCCGTCGATGTCGCCGACCGCATGGCGC
GCCTCGTCGCTTCCGACCCCGTGTTCCGCAAGGATAACAGGACTATGCTCCCCAGGAAGG
AGCTGTTCAAGGACACACTCAGAAAGGCAGCCCATGCGTGGAAGCGTATCGTCGAGCTCC
GTCTTACAGAAGAGGAGGCAAATTTGCTAAGGCTATACGTGGACCAGCCTGGTTATGTTG
ATCTGCACTGGGGCATGTTTGTTCCTGCTATAAAAGGCCAAGGGACTGAAGAGCAGCAGA
AGAAGTGGCTACCTCTGGCCTACAGGTTCCAAATAATTGGATGCTATGCTCAGACTGAAC
TTGGTCATGGTTCCAATGTTCAGGGCCTTGAAACAACCGCCACATTTGACCCAAAGACTG
ATGAGTTTGTTATACACAGCCCGACACTGACCTCTAGCAAGTGGTGGCCTGGTGGCTTGG
GAAAAGCTTCCACTCATGCAGTTGTGTATGCTCGTCTGATAACTGAAGGAAAGGACTACG
GCATACATGGTTTCATTGTGCAACTACGAAGCCTAGAGGACCACTCTCCCCTTCCCGGTG
TTACTCTTGGTGATATCGGCGGAAAATTTGGTAGTGGTGCATACAACAGTATGGATAATG
GAGTTCTGCGATTTGACCATGTGCGCATCCCAAGGGATCAAATGTTGATGAGGCTTTCAC
AAGTTACGAAAGAGGGAAAATATGTGCACTCAGATGTCCCAAAACAGCTGCTTTATGGGA
CAATGGTTTTTGTTCGTCAAACAATTGTTGCAGATGCTTCTAAGGCTTTATCACGTGCTA
CTTGCATTGCTGTAAGATACAGCGCTATTCGAAAGCAGTTTGGCCCTCAAACTGGTGGCC
CTGAGACTCAGGTCCTCAATTACAAGACTCAGCAAAGCAGACTCTTTCCTTTGCTGGCTT
CAGCTTATGCATTTAGGTTTGTGGGTGAGTGGCTGAAGTGGCTGTACACGGATGTCACAC
ATAAACTGGAAGCCAAGGATTTCTCAACACTTCAAGAGGCCCATGCCTGTACTGCTGGGT
TGAAGGCTGTGACAACATCTGCGACAGCTGATGGAATTGAAGAATGCCGAAAACTCTGTG
GTGGACATGGTTACCTGAACAGCAGCGGGCTTCCTGAATTGTTTGCTATCTATGTTCCTG
CTTGCACTTATGAAGGAGACAATGTTGTTTTGCTATTGCAGGTTGCAAGGTTTCTAATGA
AGACTGTATCCCAGTTAGCTTCTGGAAAACAGCCTGTTGGTACAACGGCTTACATGGGCA
ACATACAGTACTTGATGCAATGCAAATGTGGTGTAAATACAGCTGAAGATTGGCTAAATC
CTGCTGCCATACGAGAGGTATTTGAAGCTCGGGCTCTCAGGATGGCGGTGAATTGTGCCC
AGAACATAAACAAGGCGCCAAGCCAAGAAGAAGGGTTTTATGAGCTATCCCCTGATCTGC
TTGAGGTGGCGGTGGCCCATATCCAGTTGATAATTGTAACCAAGTTCATAGAGAAATTAG
AGCAGGACATCCCTGGTGAGGGAGTGAAGGAGCAACTGTGCATCCTTTGCAATGTGTACG
CGCTGTATCTTGTTCACAAGCATCTGGGTGACTTCCTGTCGACGGGGAGCATCACAGCAA
GGCAGGGAGCGCTGGCAAACGAGCAGCTGGGAAAGCTGTATGCGCAGGTGCGGCCGAACG
CGGTGGCGCTGGTGGACGCGTTCAACTACACCGACCACTACCTGGGGTCGGTGCTGGGGC
GCTACGACGGCAATGTTTACCCGGCGCTGTACGAGGAGGCGTGGAAGGACCCCCTCAACG
ACACGGATGTGCCGGACGGTTACCAGGAGCACCTCCGCCCTCTGCTCAAGCAGCAGCTCA
AGCTCTCCAGGCTATGATCATCCATCCATCATCCTCCCTTTCTTGCTCTATCAATCATAT
CATACTGCATACGATTTGAGTAGTAGTAAAATAACACCAGCATATGCAAGGTGCTGGCTG
GCTGCTAGTATTTTCTTTTTCTTTATAATTTATTTATTTGGGGAGAGCTGGTATTGTCTT
ATTTATTTGGGAAGAGCTGGTATTGTATGTCTGGTGATTTGGTATAGCTGTAACTGTGAA
CTTCACCACATCTCCCCCTTCTCAAGGGCATATGCATTCTACTCC

CDS

2010 bp

>Os06t0103500-01 Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).
ATGGAGGGCGGCGTAGGGGGGGAGGTGGACCACCTCGCCGGCGAGAGGGCCACCGCGCAG
TTCGACGTTGAACACATGAAGGTTGCCTGGGCTGGCTCCCGCCACGCCGTCGATGTCGCC
GACCGCATGGCGCGCCTCGTCGCTTCCGACCCCGTGTTCCGCAAGGATAACAGGACTATG
CTCCCCAGGAAGGAGCTGTTCAAGGACACACTCAGAAAGGCAGCCCATGCGTGGAAGCGT
ATCGTCGAGCTCCGTCTTACAGAAGAGGAGGCAAATTTGCTAAGGCTATACGTGGACCAG
CCTGGTTATGTTGATCTGCACTGGGGCATGTTTGTTCCTGCTATAAAAGGCCAAGGGACT
GAAGAGCAGCAGAAGAAGTGGCTACCTCTGGCCTACAGGTTCCAAATAATTGGATGCTAT
GCTCAGACTGAACTTGGTCATGGTTCCAATGTTCAGGGCCTTGAAACAACCGCCACATTT
GACCCAAAGACTGATGAGTTTGTTATACACAGCCCGACACTGACCTCTAGCAAGTGGTGG
CCTGGTGGCTTGGGAAAAGCTTCCACTCATGCAGTTGTGTATGCTCGTCTGATAACTGAA
GGAAAGGACTACGGCATACATGGTTTCATTGTGCAACTACGAAGCCTAGAGGACCACTCT
CCCCTTCCCGGTGTTACTCTTGGTGATATCGGCGGAAAATTTGGTAGTGGTGCATACAAC
AGTATGGATAATGGAGTTCTGCGATTTGACCATGTGCGCATCCCAAGGGATCAAATGTTG
ATGAGGCTTTCACAAGTTACGAAAGAGGGAAAATATGTGCACTCAGATGTCCCAAAACAG
CTGCTTTATGGGACAATGGTTTTTGTTCGTCAAACAATTGTTGCAGATGCTTCTAAGGCT
TTATCACGTGCTACTTGCATTGCTGTAAGATACAGCGCTATTCGAAAGCAGTTTGGCCCT
CAAACTGGTGGCCCTGAGACTCAGGTCCTCAATTACAAGACTCAGCAAAGCAGACTCTTT
CCTTTGCTGGCTTCAGCTTATGCATTTAGGTTTGTGGGTGAGTGGCTGAAGTGGCTGTAC
ACGGATGTCACACATAAACTGGAAGCCAAGGATTTCTCAACACTTCAAGAGGCCCATGCC
TGTACTGCTGGGTTGAAGGCTGTGACAACATCTGCGACAGCTGATGGAATTGAAGAATGC
CGAAAACTCTGTGGTGGACATGGTTACCTGAACAGCAGCGGGCTTCCTGAATTGTTTGCT
ATCTATGTTCCTGCTTGCACTTATGAAGGAGACAATGTTGTTTTGCTATTGCAGGTTGCA
AGGTTTCTAATGAAGACTGTATCCCAGTTAGCTTCTGGAAAACAGCCTGTTGGTACAACG
GCTTACATGGGCAACATACAGTACTTGATGCAATGCAAATGTGGTGTAAATACAGCTGAA
GATTGGCTAAATCCTGCTGCCATACGAGAGGTATTTGAAGCTCGGGCTCTCAGGATGGCG
GTGAATTGTGCCCAGAACATAAACAAGGCGCCAAGCCAAGAAGAAGGGTTTTATGAGCTA
TCCCCTGATCTGCTTGAGGTGGCGGTGGCCCATATCCAGTTGATAATTGTAACCAAGTTC
ATAGAGAAATTAGAGCAGGACATCCCTGGTGAGGGAGTGAAGGAGCAACTGTGCATCCTT
TGCAATGTGTACGCGCTGTATCTTGTTCACAAGCATCTGGGTGACTTCCTGTCGACGGGG
AGCATCACAGCAAGGCAGGGAGCGCTGGCAAACGAGCAGCTGGGAAAGCTGTATGCGCAG
GTGCGGCCGAACGCGGTGGCGCTGGTGGACGCGTTCAACTACACCGACCACTACCTGGGG
TCGGTGCTGGGGCGCTACGACGGCAATGTTTACCCGGCGCTGTACGAGGAGGCGTGGAAG
GACCCCCTCAACGACACGGATGTGCCGGACGGTTACCAGGAGCACCTCCGCCCTCTGCTC
AAGCAGCAGCTCAAGCTCTCCAGGCTATGA

Protein

670 aa

>Os06t0103500-01 Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).
MEGGVGGEVDHLAGERATAQFDVEHMKVAWAGSRHAVDVADRMARLVASDPVFRKDNRTM
LPRKELFKDTLRKAAHAWKRIVELRLTEEEANLLRLYVDQPGYVDLHWGMFVPAIKGQGT
EEQQKKWLPLAYRFQIIGCYAQTELGHGSNVQGLETTATFDPKTDEFVIHSPTLTSSKWW
PGGLGKASTHAVVYARLITEGKDYGIHGFIVQLRSLEDHSPLPGVTLGDIGGKFGSGAYN
SMDNGVLRFDHVRIPRDQMLMRLSQVTKEGKYVHSDVPKQLLYGTMVFVRQTIVADASKA
LSRATCIAVRYSAIRKQFGPQTGGPETQVLNYKTQQSRLFPLLASAYAFRFVGEWLKWLY
TDVTHKLEAKDFSTLQEAHACTAGLKAVTTSATADGIEECRKLCGGHGYLNSSGLPELFA
IYVPACTYEGDNVVLLLQVARFLMKTVSQLASGKQPVGTTAYMGNIQYLMQCKCGVNTAE
DWLNPAAIREVFEARALRMAVNCAQNINKAPSQEEGFYELSPDLLEVAVAHIQLIIVTKF
IEKLEQDIPGEGVKEQLCILCNVYALYLVHKHLGDFLSTGSITARQGALANEQLGKLYAQ
VRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEAWKDPLNDTDVPDGYQEHLRPLL
KQQLKLSRL*

5'UTR

chr06:227847..228013 (+ strand) : 167 bp

CDS

chr06:228014..228166 (+ strand) : 153 bp

chr06:228893..229001 (+ strand) : 109 bp

chr06:229096..229157 (+ strand) : 62 bp

chr06:229284..229493 (+ strand) : 210 bp

chr06:229609..229696 (+ strand) : 88 bp

chr06:229774..229936 (+ strand) : 163 bp

chr06:230037..230235 (+ strand) : 199 bp

chr06:230456..230653 (+ strand) : 198 bp

chr06:230887..231018 (+ strand) : 132 bp

chr06:231182..231302 (+ strand) : 121 bp

chr06:231453..231563 (+ strand) : 111 bp

chr06:231710..231779 (+ strand) : 70 bp

chr06:231880..232063 (+ strand) : 184 bp

chr06:232137..232346 (+ strand) : 210 bp

3'UTR

chr06:232347..232614 (+ strand) : 268 bp

FASTA

>Os06t0103500-01 class=Sequence position=chr06:227847..232614 (+ strand)
AACTCCCAAC TCCCAAGTTG CAATCGAGAA TAAATAAAAA TCCCAATCCC CTCCTTCTCT TCTTCTTCCT CCCTGTTCCC
TTTTCGATTC GATTGGATTG GATTGTTTTG CTGGCTCGCT CTCTCTCTCT CTCTCGTGGT GTGGTGTGGA CAAGAAAGGA
AGGAAAGATG GAGGGCGGCG TAGGGGGGGA GGTGGACCAC CTCGCCGGCG AGAGGGCCAC CGCGCAGTTC GACGTTGAAC
ACATGAAGGT TGCCTGGGCT GGCTCCCGCC ACGCCGTCGA TGTCGCCGAC CGCATGGCGC GCCTCGTCGC TTCCGACCCC
GTAACAATAA CTTTCTCCCT CTTTCTTTCT TTCTTTGCAC AGATAGATAG ATAGATTATC AACTTCGGCT CCCCGGATCT
CTGATTAAAT TACCTGTATG ATGCTCTTCT TCTCTTCCCC CAATCCTTCT TTCCTTGTTC TTCAACAACC ACACCACGCC
GGCCCGATTT TACCCCACGA TAATAATTTC ATATATTATT TTTAGTTTAC TAGCAGCAGC CAGCAGGAGT ATTTAGTTGA
TACTGTTTCG CTGACTTGTT TGCTACCCTA ATTATTATTA TTAAGGAGTA TTTTTTTTAG CTAGATGCGA TGCGATGCGA
TGCTTATTCC ACTGCTCCTG CTCTTTCTTC CACACATATC TCCTCTTTTA CTATTATTAG TATTGTCACT AGTAATATTA
TTTATATTCT GCTATAGTGA TTTTCTCCTC AGATCAGATC TACCAAAACC TTGTACCCAC ACAAATATCT TCTACTCTCT
TTTTTTTCTG ATACTAAACA TTATAATATA GCTAGCTGCG CTACAAGATC GATAGAAATT TCTCAGCACC ATACATTATG
AATCATCTCC ATATATGATG TATCAGTAAT AACAGTAACA ATGTACCAAT TGCTACGTGT TTTTCTGTAG CCTCCTCTTT
GCTAACAAAT GCTAAAATGC TATAAACAAA ACAATCCATT ACGCTCACAA TGGTTTCCTT ACATTTTTGA CTCCTTTCCA
ATCTAGGTGT TCCGCAAGGA TAACAGGACT ATGCTCCCCA GGAAGGAGCT GTTCAAGGAC ACACTCAGAA AGGCAGCCCA
TGCGTGGAAG CGTATCGTCG AGCTCCGTCT TACAGGTCAG GTCCCAATCC CGTGATGCTT CTTCTTCTTT TATTAACAAC
TGATCTTCCT ACTCTTAACT CATGTAATGG TGTTGTTGTC CATTAACAGA AGAGGAGGCA AATTTGCTAA GGCTATACGT
GGACCAGCCT GGTTATGTTG ATCTGCACTG GGTACTAATA TCGACCATAT TATCTTCACT ATCTACTCCA ATATACAGCA
CTGAAGCTGC TCAATTTTAT CCACAAGCTC GATTAATTAA TAGGGAACAA TACTTTGTGC AAAATTTTAT TTTGCAGGGC
ATGTTTGTTC CTGCTATAAA AGGCCAAGGG ACTGAAGAGC AGCAGAAGAA GTGGCTACCT CTGGCCTACA GGTTCCAAAT
AATTGGATGC TATGCTCAGA CTGAACTTGG TCATGGTTCC AATGTTCAGG GCCTTGAAAC AACCGCCACA TTTGACCCAA
AGACTGATGA GTTTGTTATA CACAGCCCGA CACTGACCTC TAGCAAGGTA ATACTCCTAT CTACTCTTCC TCTCTTATCT
ATTAAGATGC TACATTTCTT CTTTAATTTG GAATTTCTTC AATATCTTGT TGCATGGTTC ATGATTTTAT CCCCATGTGC
AGTGGTGGCC TGGTGGCTTG GGAAAAGCTT CCACTCATGC AGTTGTGTAT GCTCGTCTGA TAACTGAAGG AAAGGACTAC
GGCATACATG GTAGAGTCTC TTGTATTTTG AAGGTGACTT TTAAGCAGTA TCTTTCTTTT TGCGACTCAT GACTATCTAT
ATATCAGGTT TCATTGTGCA ACTACGAAGC CTAGAGGACC ACTCTCCCCT TCCCGGTGTT ACTCTTGGTG ATATCGGCGG
AAAATTTGGT AGTGGTGCAT ACAACAGTAT GGATAATGGA GTTCTGCGAT TTGACCATGT GCGCATCCCA AGGGATCAAA
TGTTGATGAG GTTTGTCCAT TGGGTTATCA TGTTTTGTTC GGGCACTTGT CAAATACATT CTGATACCTT GATGTAACCA
TTCTCAAGCA CACCCATGCT ACTCGTGTAG GCTTTCACAA GTTACGAAAG AGGGAAAATA TGTGCACTCA GATGTCCCAA
AACAGCTGCT TTATGGGACA ATGGTTTTTG TTCGTCAAAC AATTGTTGCA GATGCTTCTA AGGCTTTATC ACGTGCTACT
TGCATTGCTG TAAGATACAG CGCTATTCGA AAGCAGTTTG GCCCTCAAAC TGGTGGCCCT GAGACTCAGG TACTATGTCA
GATTTGAATT TTTTTTTGTA TTACCACTTA TTAATTTGTT TTTATGCTCT TGAAACATTT CCTGTGACAT GTATTCCTTT
TGCTTTTACT GGAAAAACCA TTGTCTGAGT TAATATTTGT ACTTTGTTCA TCTAAAAGAA TTAAATTGAT AAACGAGTTT
AACTTTTTGC TACCAATGAC AAGTGGCTAA TGGTCTATAA TGGTTACAGG TCCTCAATTA CAAGACTCAG CAAAGCAGAC
TCTTTCCTTT GCTGGCTTCA GCTTATGCAT TTAGGTTTGT GGGTGAGTGG CTGAAGTGGC TGTACACGGA TGTCACACAT
AAACTGGAAG CCAAGGATTT CTCAACACTT CAAGAGGCCC ATGCCTGTAC TGCTGGGTTG AAGGCTGTGA CAACATCTGC
GACAGCTGTG TGTACAATTA TTTAATTCAG TACCACTTTT AATGGTTATA CTTGCTGACT GGTCATACTA AGCCTGCAAA
TTCATACTTT TGCTTTATCA GTACACATCC TTAAAATGAA TAATGGTCAG ATCGCATCAA TGAGTTTACA CGCATAGCTG
GTCCAACAGT CTAGCCAGTT TATATAACGA GTGAATTACA CAATTTTCAT TGTTCTCAAA CCTGTTTTTT TTTAATGCAG
GATGGAATTG AAGAATGCCG AAAACTCTGT GGTGGACATG GTTACCTGAA CAGCAGCGGG CTTCCTGAAT TGTTTGCTAT
CTATGTTCCT GCTTGCACTT ATGAAGGAGA CAATGTTGTT TTGCTATTGC AGGTTAGTAT GCTATTGTTG TTTTGTTCTG
TGGATACTAA TAACTCTCCT ACCTGCTTGT GGTTGTGTGG ATGGCCTAGC TTGTTGGGCC GAATCATAGG TCCAGTCCTT
CAAGTTTCCT CAGTTTTGGT CAATTTACAG TCATAACCTT TGGTGCTCTC TGCAGGTTGC AAGGTTTCTA ATGAAGACTG
TATCCCAGTT AGCTTCTGGA AAACAGCCTG TTGGTACAAC GGCTTACATG GGCAACATAC AGTACTTGAT GCAATGCAAA
TGTGGTGTAA ATACAGGTAT ATAGTTGTAT CTTCTGGCAG GCTCCTGTTT TAGACAGCTG TATGCCAGTC ATCACTGTAC
GTTATGTATA TATATGCCCA TTGCTGGGAA GCCATTGATG TTGAGATGAA TGCCATAGTG ATTCATTTTT CCATGATTAT
CGACAGCTGA AGATTGGCTA AATCCTGCTG CCATACGAGA GGTATTTGAA GCTCGGGCTC TCAGGATGGC GGTGAATTGT
GCCCAGAACA TAAACAAGGC GCCAAGCCAA GAAGAAGGTT GGTATTGCGC CATATGATTA TTAATCGAGA ATAAAATATA
GAACAGAAAC CATAGTGCAT TTGCATGTAG TTTCGTATTA ATTTCCGTGG TCTATTATAA GAAATTGCAT AGATGATGAT
GGTGTGCGTT GCTGAATATG CAGGGTTTTA TGAGCTATCC CCTGATCTGC TTGAGGTGGC GGTGGCCCAT ATCCAGTTGA
TAATTGTAAC CAAGTGAGTA TTGCCTAGGA TGAAAGAAAT CTGAAGTATG GCTTCATTTA TATTTTATTG GCATTTATTT
ATTTCGGTGT GTTATGGTAC GTATAATGGT TAGGTTCATA GAGAAATTAG AGCAGGACAT CCCTGGTGAG GGAGTGAAGG
AGCAACTGTG CATCCTTTGC AATGTGTACG CGCTGTATCT TGTTCACAAG CATCTGGGTG ACTTCCTGTC GACGGGGAGC
ATCACAGCAA GGCAGGGAGC GCTGGCAAAC GAGCAGCTGG GAAAGCTGTA TGCGCAGGTA TGGTGTCCTC CGTCGATGTC
AATGTCAAAA GTGGATGAGA AACTGAGAAA TGAGACAAAT GCAAATGCAG GTGCGGCCGA ACGCGGTGGC GCTGGTGGAC
GCGTTCAACT ACACCGACCA CTACCTGGGG TCGGTGCTGG GGCGCTACGA CGGCAATGTT TACCCGGCGC TGTACGAGGA
GGCGTGGAAG GACCCCCTCA ACGACACGGA TGTGCCGGAC GGTTACCAGG AGCACCTCCG CCCTCTGCTC AAGCAGCAGC
TCAAGCTCTC CAGGCTATGA TCATCCATCC ATCATCCTCC CTTTCTTGCT CTATCAATCA TATCATACTG CATACGATTT
GAGTAGTAGT AAAATAACAC CAGCATATGC AAGGTGCTGG CTGGCTGCTA GTATTTTCTT TTTCTTTATA ATTTATTTAT
TTGGGGAGAG CTGGTATTGT CTTATTTATT TGGGAAGAGC TGGTATTGTA TGTCTGGTGA TTTGGTATAG CTGTAACTGT
GAACTTCACC ACATCTCCCC CTTCTCAAGG GCATATGCAT TCTACTCC

Locus: Os06g0103500

Loading...

Locus: Os06g0103500

Loading...