Os06t0103500-02

Locus

Os06g0103500

Description

Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ACX1, OsACX1

Oryzabase Gene Name Synonym(s)

acyl-CoA oxidase 1

Transcript Evidence

AK098983 (DDBJ, Best hit)

Protein Evidence

E9L0E1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: fatty acid metabolic process (GO:0006631)

Biological Process: fatty acid beta-oxidation (GO:0006635)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Cellular Component: peroxisome (GO:0005777)

Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995)

Molecular Function: acyl-CoA oxidase activity (GO:0003997)

Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Functional domain (InterPro)

Acyl-CoA oxidase, C-terminal (IPR002655)

Acyl-CoA oxidase/dehydrogenase, central domain (IPR006091)

Acyl-CoA dehydrogenase/oxidase C-terminal (IPR009075)

Acyl-CoA dehydrogenase/oxidase (IPR009100)

Acyl-CoA oxidase (IPR012258)

Acyl-CoA dehydrogenase/oxidase, N-terminal (IPR013786)

Acyl-CoA oxidase, peroxisomal (IPR023570)

Full-length cDNA

J013091M04 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0103500-02)

RiceXPro (AK098983)

Others

Oryzabase (22011)

KEGG (Os06t0103500-02 (EC:1.3.3.6))

Transcript

2384 bp

>Os06t0103500-02 Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).
CTTCTTCCTCCCTGTTCCCTTTTCGATTCGATTGGATTGGATTGTTTTGCTGGCTCGCTC
TCTCTCTCTCTCTCGTGGTGTGGTGTGGACAAGAAAGGAAGGAAAGATGGAGGGCGGCGT
AGGGGGGGAGGTGGACCACCTCGCCGGCGAGAGGGCCACCGCGCAGTTCGACGTTGAACA
CATGAAGGTTGCCTGGGCTGGCTCCCGCCACGCCGTCGATGTCGCCGACCGCATGGCGCG
CCTCGTCGCTTCCGACCCCGTGTTCCGCAAGGATAACAGGACTATGCTCCCCAGGAAGGA
GCTGTTCAAGGACACACTCAGAAAGGCAGCCCATGCGTGGAAGCGTATCGTCGAGCTCCG
TCTTACAGAAGAGGAGGCAAATTTGCTAAGGCTATACGTGGACCAGCCTGGTTATGTTGA
TCTGCACTGGGGCATGTTTGTTCCTGCTATAAAAGGCCAAGGGACTGAAGAGCAGCAGAA
GAAGTGGCTACCTCTGGCCTACAGGTTCCAAATAATTGGATGCTATGCTCAGACTGAACT
TGGTCATGGTTCCAATGTTCAGGGCCTTGAAACAACCGCCACATTTGACCCAAAGACTGA
TGAGTTTGTTATACACAGCCCGACACTGACCTCTAGCAAGTGGTGGCCTGGTGGCTTGGG
AAAAGCTTCCACTCATGCAGTTGTGTATGCTCGTCTGATAACTGAAGGAAAGGACTACGG
CATACATGGTTTCATTGTGCAACTACGAAGCCTAGAGGACCACTCTCCCCTTCCCGGTGT
TACTCTTGGTGATATCGGCGGAAAATTTGGTAGTGGTGCATACAACAGTATGGATAATGG
AGTTCTGCGATTTGACCATGTGCGCATCCCAAGGGATCAAATGTTGATGAGGCTTTCACA
AGTTACGAAAGAGGGAAAATATGTGCACTCAGATGTCCCAAAACAGCTGCTTTATGGGAC
AATGGTTTTTGTTCGTCAAACAATTGTTGCAGATGCTTCTAAGGCTTTATCACGTGCTAC
TTGCATTGCTGTAAGATACAGCGCTATTCGAAAGCAGTTTGGCCCTCAAACTGGTGGCCC
TGAGACTCAGGTCCTCAATTACAAGACTCAGCAAAGCAGACTCTTTCCTTTGCTGGCTTC
AGCTTATGCATTTAGGTTTGTGGGTGAGTGGCTGAAGTGGCTGTACACGGATGTCACACA
TAAACTGGAAGCCAAGGATTTCTCAACACTTCAAGAGGCCCATGCCTGTACTGCTGGGTT
GAAGGCTGTGACAACATCTGCGACAGCTGATGGAATTGAAGAATGCCGAAAACTCTGTGG
TGGACATGGTTACCTGAACAGCAGCGGGCTTCCTGAATTGTTTGCTATCTATGTTCCTGC
TTGCACTTATGAAGGAGACAATGTTGTTTTGCTATTGCAGGTTGCAAGGTTTCTAATGAA
GACTGTATCCCAGTTAGCTTCTGGAAAACAGCCTGTTGGTACAACGGCTTACATGGGCAA
CATACAGTACTTGATGCAATGCAAATGTGGTGTAAATACAGCTGAAGATTGGCTAAATCC
TGCTGCCATACGAGAGGTATTTGAAGCTCGGGCTCTCAGGATGGCGGTGAATTGTGCCCA
GAACATAAACAAGGCGCCAAGCCAAGAAGAAGGGTTTTATGAGCTATCCCCTGATCTGCT
TGAGGTGGCGGTGGCCCATATCCAGTTGATAATTGTAACCAAGTTCATAGAGAAATTAGA
GCAGGACATCCCTGGTGAGGGAGTGAAGGAGCAACTGTGCATCCTTTGCAATGTGTACGC
GCTGTATCTTGTTCACAAGCATCTGGGTGACTTCCTGTCGACGGGGAGCATCACAGCAAG
GCAGGGAGCGCTGGCAAACGAGCAGCTGGGAAAGCTGTATGCGCAGGTGCGGCCGAACGC
GGTGGCGCTGGTGGACGCGTTCAACTACACCGACCACTACCTGGGGTCGGTGCTGGGGCG
CTACGACGGCAATGTTTACCCGGCGCTGTACGAGGAGGCGTGGAAGGACCCCCTCAACGA
CACGGATGTGCCGGACGGTTACCAGGAGCACCTCCGCCCTCTGCTCAAGCAGCAGCTCAA
GCTCTCCAGGCTATGATCATCCATCCATCATCCTCCCTTTCTTGCTCTATCAATCATATC
ATACTGCATACGATTTGAGTAGTAGTAAAATAACACCAGCATATGCAAGGTGCTGGCTGG
CTGCTAGTATTTTCTTTTTCTTTATAATTTATTTATTTGGGGAGAGCTGGTATTGTCTTA
TTTATTTGGGAAGAGCTGGTATTGTATGTCTGGTGATTTGGTATAGCTGTAACTGTGAAC
TTCACCACATCTCCCCCTTCTCAAGGGCATATGCATTCTACTCC

CDS

2010 bp

>Os06t0103500-02 Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).
ATGGAGGGCGGCGTAGGGGGGGAGGTGGACCACCTCGCCGGCGAGAGGGCCACCGCGCAG
TTCGACGTTGAACACATGAAGGTTGCCTGGGCTGGCTCCCGCCACGCCGTCGATGTCGCC
GACCGCATGGCGCGCCTCGTCGCTTCCGACCCCGTGTTCCGCAAGGATAACAGGACTATG
CTCCCCAGGAAGGAGCTGTTCAAGGACACACTCAGAAAGGCAGCCCATGCGTGGAAGCGT
ATCGTCGAGCTCCGTCTTACAGAAGAGGAGGCAAATTTGCTAAGGCTATACGTGGACCAG
CCTGGTTATGTTGATCTGCACTGGGGCATGTTTGTTCCTGCTATAAAAGGCCAAGGGACT
GAAGAGCAGCAGAAGAAGTGGCTACCTCTGGCCTACAGGTTCCAAATAATTGGATGCTAT
GCTCAGACTGAACTTGGTCATGGTTCCAATGTTCAGGGCCTTGAAACAACCGCCACATTT
GACCCAAAGACTGATGAGTTTGTTATACACAGCCCGACACTGACCTCTAGCAAGTGGTGG
CCTGGTGGCTTGGGAAAAGCTTCCACTCATGCAGTTGTGTATGCTCGTCTGATAACTGAA
GGAAAGGACTACGGCATACATGGTTTCATTGTGCAACTACGAAGCCTAGAGGACCACTCT
CCCCTTCCCGGTGTTACTCTTGGTGATATCGGCGGAAAATTTGGTAGTGGTGCATACAAC
AGTATGGATAATGGAGTTCTGCGATTTGACCATGTGCGCATCCCAAGGGATCAAATGTTG
ATGAGGCTTTCACAAGTTACGAAAGAGGGAAAATATGTGCACTCAGATGTCCCAAAACAG
CTGCTTTATGGGACAATGGTTTTTGTTCGTCAAACAATTGTTGCAGATGCTTCTAAGGCT
TTATCACGTGCTACTTGCATTGCTGTAAGATACAGCGCTATTCGAAAGCAGTTTGGCCCT
CAAACTGGTGGCCCTGAGACTCAGGTCCTCAATTACAAGACTCAGCAAAGCAGACTCTTT
CCTTTGCTGGCTTCAGCTTATGCATTTAGGTTTGTGGGTGAGTGGCTGAAGTGGCTGTAC
ACGGATGTCACACATAAACTGGAAGCCAAGGATTTCTCAACACTTCAAGAGGCCCATGCC
TGTACTGCTGGGTTGAAGGCTGTGACAACATCTGCGACAGCTGATGGAATTGAAGAATGC
CGAAAACTCTGTGGTGGACATGGTTACCTGAACAGCAGCGGGCTTCCTGAATTGTTTGCT
ATCTATGTTCCTGCTTGCACTTATGAAGGAGACAATGTTGTTTTGCTATTGCAGGTTGCA
AGGTTTCTAATGAAGACTGTATCCCAGTTAGCTTCTGGAAAACAGCCTGTTGGTACAACG
GCTTACATGGGCAACATACAGTACTTGATGCAATGCAAATGTGGTGTAAATACAGCTGAA
GATTGGCTAAATCCTGCTGCCATACGAGAGGTATTTGAAGCTCGGGCTCTCAGGATGGCG
GTGAATTGTGCCCAGAACATAAACAAGGCGCCAAGCCAAGAAGAAGGGTTTTATGAGCTA
TCCCCTGATCTGCTTGAGGTGGCGGTGGCCCATATCCAGTTGATAATTGTAACCAAGTTC
ATAGAGAAATTAGAGCAGGACATCCCTGGTGAGGGAGTGAAGGAGCAACTGTGCATCCTT
TGCAATGTGTACGCGCTGTATCTTGTTCACAAGCATCTGGGTGACTTCCTGTCGACGGGG
AGCATCACAGCAAGGCAGGGAGCGCTGGCAAACGAGCAGCTGGGAAAGCTGTATGCGCAG
GTGCGGCCGAACGCGGTGGCGCTGGTGGACGCGTTCAACTACACCGACCACTACCTGGGG
TCGGTGCTGGGGCGCTACGACGGCAATGTTTACCCGGCGCTGTACGAGGAGGCGTGGAAG
GACCCCCTCAACGACACGGATGTGCCGGACGGTTACCAGGAGCACCTCCGCCCTCTGCTC
AAGCAGCAGCTCAAGCTCTCCAGGCTATGA

Protein

670 aa

>Os06t0103500-02 Similar to Acyl-coenzyme A oxidase 1, peroxisomal (EC 1.3.3.6) (AOX 1) (Long- chain acyl-CoA oxidase) (AtCX1).
MEGGVGGEVDHLAGERATAQFDVEHMKVAWAGSRHAVDVADRMARLVASDPVFRKDNRTM
LPRKELFKDTLRKAAHAWKRIVELRLTEEEANLLRLYVDQPGYVDLHWGMFVPAIKGQGT
EEQQKKWLPLAYRFQIIGCYAQTELGHGSNVQGLETTATFDPKTDEFVIHSPTLTSSKWW
PGGLGKASTHAVVYARLITEGKDYGIHGFIVQLRSLEDHSPLPGVTLGDIGGKFGSGAYN
SMDNGVLRFDHVRIPRDQMLMRLSQVTKEGKYVHSDVPKQLLYGTMVFVRQTIVADASKA
LSRATCIAVRYSAIRKQFGPQTGGPETQVLNYKTQQSRLFPLLASAYAFRFVGEWLKWLY
TDVTHKLEAKDFSTLQEAHACTAGLKAVTTSATADGIEECRKLCGGHGYLNSSGLPELFA
IYVPACTYEGDNVVLLLQVARFLMKTVSQLASGKQPVGTTAYMGNIQYLMQCKCGVNTAE
DWLNPAAIREVFEARALRMAVNCAQNINKAPSQEEGFYELSPDLLEVAVAHIQLIIVTKF
IEKLEQDIPGEGVKEQLCILCNVYALYLVHKHLGDFLSTGSITARQGALANEQLGKLYAQ
VRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEAWKDPLNDTDVPDGYQEHLRPLL
KQQLKLSRL*

5'UTR

chr06:227908..228013 (+ strand) : 106 bp

CDS

chr06:228014..228166 (+ strand) : 153 bp

chr06:228893..229001 (+ strand) : 109 bp

chr06:229096..229157 (+ strand) : 62 bp

chr06:229284..229493 (+ strand) : 210 bp

chr06:229609..229696 (+ strand) : 88 bp

chr06:229774..229936 (+ strand) : 163 bp

chr06:230037..230235 (+ strand) : 199 bp

chr06:230456..230653 (+ strand) : 198 bp

chr06:230887..231018 (+ strand) : 132 bp

chr06:231182..231302 (+ strand) : 121 bp

chr06:231453..231563 (+ strand) : 111 bp

chr06:231710..231779 (+ strand) : 70 bp

chr06:231880..232063 (+ strand) : 184 bp

chr06:232137..232346 (+ strand) : 210 bp

3'UTR

chr06:232347..232614 (+ strand) : 268 bp

FASTA

>Os06t0103500-02 class=Sequence position=chr06:227908..232614 (+ strand)
CTTCTTCCTC CCTGTTCCCT TTTCGATTCG ATTGGATTGG ATTGTTTTGC TGGCTCGCTC TCTCTCTCTC TCTCGTGGTG
TGGTGTGGAC AAGAAAGGAA GGAAAGATGG AGGGCGGCGT AGGGGGGGAG GTGGACCACC TCGCCGGCGA GAGGGCCACC
GCGCAGTTCG ACGTTGAACA CATGAAGGTT GCCTGGGCTG GCTCCCGCCA CGCCGTCGAT GTCGCCGACC GCATGGCGCG
CCTCGTCGCT TCCGACCCCG TAACAATAAC TTTCTCCCTC TTTCTTTCTT TCTTTGCACA GATAGATAGA TAGATTATCA
ACTTCGGCTC CCCGGATCTC TGATTAAATT ACCTGTATGA TGCTCTTCTT CTCTTCCCCC AATCCTTCTT TCCTTGTTCT
TCAACAACCA CACCACGCCG GCCCGATTTT ACCCCACGAT AATAATTTCA TATATTATTT TTAGTTTACT AGCAGCAGCC
AGCAGGAGTA TTTAGTTGAT ACTGTTTCGC TGACTTGTTT GCTACCCTAA TTATTATTAT TAAGGAGTAT TTTTTTTAGC
TAGATGCGAT GCGATGCGAT GCTTATTCCA CTGCTCCTGC TCTTTCTTCC ACACATATCT CCTCTTTTAC TATTATTAGT
ATTGTCACTA GTAATATTAT TTATATTCTG CTATAGTGAT TTTCTCCTCA GATCAGATCT ACCAAAACCT TGTACCCACA
CAAATATCTT CTACTCTCTT TTTTTTCTGA TACTAAACAT TATAATATAG CTAGCTGCGC TACAAGATCG ATAGAAATTT
CTCAGCACCA TACATTATGA ATCATCTCCA TATATGATGT ATCAGTAATA ACAGTAACAA TGTACCAATT GCTACGTGTT
TTTCTGTAGC CTCCTCTTTG CTAACAAATG CTAAAATGCT ATAAACAAAA CAATCCATTA CGCTCACAAT GGTTTCCTTA
CATTTTTGAC TCCTTTCCAA TCTAGGTGTT CCGCAAGGAT AACAGGACTA TGCTCCCCAG GAAGGAGCTG TTCAAGGACA
CACTCAGAAA GGCAGCCCAT GCGTGGAAGC GTATCGTCGA GCTCCGTCTT ACAGGTCAGG TCCCAATCCC GTGATGCTTC
TTCTTCTTTT ATTAACAACT GATCTTCCTA CTCTTAACTC ATGTAATGGT GTTGTTGTCC ATTAACAGAA GAGGAGGCAA
ATTTGCTAAG GCTATACGTG GACCAGCCTG GTTATGTTGA TCTGCACTGG GTACTAATAT CGACCATATT ATCTTCACTA
TCTACTCCAA TATACAGCAC TGAAGCTGCT CAATTTTATC CACAAGCTCG ATTAATTAAT AGGGAACAAT ACTTTGTGCA
AAATTTTATT TTGCAGGGCA TGTTTGTTCC TGCTATAAAA GGCCAAGGGA CTGAAGAGCA GCAGAAGAAG TGGCTACCTC
TGGCCTACAG GTTCCAAATA ATTGGATGCT ATGCTCAGAC TGAACTTGGT CATGGTTCCA ATGTTCAGGG CCTTGAAACA
ACCGCCACAT TTGACCCAAA GACTGATGAG TTTGTTATAC ACAGCCCGAC ACTGACCTCT AGCAAGGTAA TACTCCTATC
TACTCTTCCT CTCTTATCTA TTAAGATGCT ACATTTCTTC TTTAATTTGG AATTTCTTCA ATATCTTGTT GCATGGTTCA
TGATTTTATC CCCATGTGCA GTGGTGGCCT GGTGGCTTGG GAAAAGCTTC CACTCATGCA GTTGTGTATG CTCGTCTGAT
AACTGAAGGA AAGGACTACG GCATACATGG TAGAGTCTCT TGTATTTTGA AGGTGACTTT TAAGCAGTAT CTTTCTTTTT
GCGACTCATG ACTATCTATA TATCAGGTTT CATTGTGCAA CTACGAAGCC TAGAGGACCA CTCTCCCCTT CCCGGTGTTA
CTCTTGGTGA TATCGGCGGA AAATTTGGTA GTGGTGCATA CAACAGTATG GATAATGGAG TTCTGCGATT TGACCATGTG
CGCATCCCAA GGGATCAAAT GTTGATGAGG TTTGTCCATT GGGTTATCAT GTTTTGTTCG GGCACTTGTC AAATACATTC
TGATACCTTG ATGTAACCAT TCTCAAGCAC ACCCATGCTA CTCGTGTAGG CTTTCACAAG TTACGAAAGA GGGAAAATAT
GTGCACTCAG ATGTCCCAAA ACAGCTGCTT TATGGGACAA TGGTTTTTGT TCGTCAAACA ATTGTTGCAG ATGCTTCTAA
GGCTTTATCA CGTGCTACTT GCATTGCTGT AAGATACAGC GCTATTCGAA AGCAGTTTGG CCCTCAAACT GGTGGCCCTG
AGACTCAGGT ACTATGTCAG ATTTGAATTT TTTTTTGTAT TACCACTTAT TAATTTGTTT TTATGCTCTT GAAACATTTC
CTGTGACATG TATTCCTTTT GCTTTTACTG GAAAAACCAT TGTCTGAGTT AATATTTGTA CTTTGTTCAT CTAAAAGAAT
TAAATTGATA AACGAGTTTA ACTTTTTGCT ACCAATGACA AGTGGCTAAT GGTCTATAAT GGTTACAGGT CCTCAATTAC
AAGACTCAGC AAAGCAGACT CTTTCCTTTG CTGGCTTCAG CTTATGCATT TAGGTTTGTG GGTGAGTGGC TGAAGTGGCT
GTACACGGAT GTCACACATA AACTGGAAGC CAAGGATTTC TCAACACTTC AAGAGGCCCA TGCCTGTACT GCTGGGTTGA
AGGCTGTGAC AACATCTGCG ACAGCTGTGT GTACAATTAT TTAATTCAGT ACCACTTTTA ATGGTTATAC TTGCTGACTG
GTCATACTAA GCCTGCAAAT TCATACTTTT GCTTTATCAG TACACATCCT TAAAATGAAT AATGGTCAGA TCGCATCAAT
GAGTTTACAC GCATAGCTGG TCCAACAGTC TAGCCAGTTT ATATAACGAG TGAATTACAC AATTTTCATT GTTCTCAAAC
CTGTTTTTTT TTAATGCAGG ATGGAATTGA AGAATGCCGA AAACTCTGTG GTGGACATGG TTACCTGAAC AGCAGCGGGC
TTCCTGAATT GTTTGCTATC TATGTTCCTG CTTGCACTTA TGAAGGAGAC AATGTTGTTT TGCTATTGCA GGTTAGTATG
CTATTGTTGT TTTGTTCTGT GGATACTAAT AACTCTCCTA CCTGCTTGTG GTTGTGTGGA TGGCCTAGCT TGTTGGGCCG
AATCATAGGT CCAGTCCTTC AAGTTTCCTC AGTTTTGGTC AATTTACAGT CATAACCTTT GGTGCTCTCT GCAGGTTGCA
AGGTTTCTAA TGAAGACTGT ATCCCAGTTA GCTTCTGGAA AACAGCCTGT TGGTACAACG GCTTACATGG GCAACATACA
GTACTTGATG CAATGCAAAT GTGGTGTAAA TACAGGTATA TAGTTGTATC TTCTGGCAGG CTCCTGTTTT AGACAGCTGT
ATGCCAGTCA TCACTGTACG TTATGTATAT ATATGCCCAT TGCTGGGAAG CCATTGATGT TGAGATGAAT GCCATAGTGA
TTCATTTTTC CATGATTATC GACAGCTGAA GATTGGCTAA ATCCTGCTGC CATACGAGAG GTATTTGAAG CTCGGGCTCT
CAGGATGGCG GTGAATTGTG CCCAGAACAT AAACAAGGCG CCAAGCCAAG AAGAAGGTTG GTATTGCGCC ATATGATTAT
TAATCGAGAA TAAAATATAG AACAGAAACC ATAGTGCATT TGCATGTAGT TTCGTATTAA TTTCCGTGGT CTATTATAAG
AAATTGCATA GATGATGATG GTGTGCGTTG CTGAATATGC AGGGTTTTAT GAGCTATCCC CTGATCTGCT TGAGGTGGCG
GTGGCCCATA TCCAGTTGAT AATTGTAACC AAGTGAGTAT TGCCTAGGAT GAAAGAAATC TGAAGTATGG CTTCATTTAT
ATTTTATTGG CATTTATTTA TTTCGGTGTG TTATGGTACG TATAATGGTT AGGTTCATAG AGAAATTAGA GCAGGACATC
CCTGGTGAGG GAGTGAAGGA GCAACTGTGC ATCCTTTGCA ATGTGTACGC GCTGTATCTT GTTCACAAGC ATCTGGGTGA
CTTCCTGTCG ACGGGGAGCA TCACAGCAAG GCAGGGAGCG CTGGCAAACG AGCAGCTGGG AAAGCTGTAT GCGCAGGTAT
GGTGTCCTCC GTCGATGTCA ATGTCAAAAG TGGATGAGAA ACTGAGAAAT GAGACAAATG CAAATGCAGG TGCGGCCGAA
CGCGGTGGCG CTGGTGGACG CGTTCAACTA CACCGACCAC TACCTGGGGT CGGTGCTGGG GCGCTACGAC GGCAATGTTT
ACCCGGCGCT GTACGAGGAG GCGTGGAAGG ACCCCCTCAA CGACACGGAT GTGCCGGACG GTTACCAGGA GCACCTCCGC
CCTCTGCTCA AGCAGCAGCT CAAGCTCTCC AGGCTATGAT CATCCATCCA TCATCCTCCC TTTCTTGCTC TATCAATCAT
ATCATACTGC ATACGATTTG AGTAGTAGTA AAATAACACC AGCATATGCA AGGTGCTGGC TGGCTGCTAG TATTTTCTTT
TTCTTTATAA TTTATTTATT TGGGGAGAGC TGGTATTGTC TTATTTATTT GGGAAGAGCT GGTATTGTAT GTCTGGTGAT
TTGGTATAGC TGTAACTGTG AACTTCACCA CATCTCCCCC TTCTCAAGGG CATATGCATT CTACTCC

Locus: Os06g0103500

Loading...

Locus: Os06g0103500

Loading...