Os06t0103500-03

Locus

Os06g0103500

Description

Similar to Acyl-CoA dehydrogenase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ACX1, OsACX1

Oryzabase Gene Name Synonym(s)

acyl-CoA oxidase 1

Transcript Evidence

AK063051 (DDBJ, Best hit)

Protein Evidence

C1K4P6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-110-E05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0103500-03)

RiceXPro (AK063051)

Others

Oryzabase (22011)

KEGG (Os06t0103500-03 (EC:1.3.3.6))

Transcript

443 bp

>Os06t0103500-03 Similar to Acyl-CoA dehydrogenase (Fragment).
CTTCCTCCCTGTTCCCTTTTCGATTCGATTGGATTGGATTGTTTTGCTGGCTCGCTCTCT
CTCTCTCTCTCGTGGTGTGGTGTGGACAAGAAAGGAAGGAAAGATGGAGGGCGGCGTAGG
GGGGGAGGTGGACCACCTCGCCGGCGAGAGGGCCACCGCGCAGTTCGACGTTGAACACAT
GAAGGTTGCCTGGGCTGGCTCCCGCCACGCCGTCGATGTCGCCGACCGCATGGCGCGCCT
CGTCGCTTCCGACCCCGTAACAATAACTTTCTCCCTCTTTCTTTCTTTCTTTGCACAGAT
AGATAGATAGATTATCAACTTCGGCTCCCCGGATCTCTGATTAAATTACCTGTATGATGC
TCTTCTTCTCTTCCCCCAATCCTTCTTTCCTTGTTCTTCAACAACCACACCACGCCGGCC
CGATTTTACCCCACGATAATAAT

CDS

207 bp

>Os06t0103500-03 Similar to Acyl-CoA dehydrogenase (Fragment).
ATGGAGGGCGGCGTAGGGGGGGAGGTGGACCACCTCGCCGGCGAGAGGGCCACCGCGCAG
TTCGACGTTGAACACATGAAGGTTGCCTGGGCTGGCTCCCGCCACGCCGTCGATGTCGCC
GACCGCATGGCGCGCCTCGTCGCTTCCGACCCCGTAACAATAACTTTCTCCCTCTTTCTT
TCTTTCTTTGCACAGATAGATAGATAG

Protein

69 aa

>Os06t0103500-03 Similar to Acyl-CoA dehydrogenase (Fragment).
MEGGVGGEVDHLAGERATAQFDVEHMKVAWAGSRHAVDVADRMARLVASDPVTITFSLFL
SFFAQIDR*

5'UTR

chr06:227911..228013 (+ strand) : 103 bp

CDS

chr06:228014..228220 (+ strand) : 207 bp

3'UTR

chr06:228221..228353 (+ strand) : 133 bp

FASTA

>Os06t0103500-03 class=Sequence position=chr06:227911..228353 (+ strand)
CTTCCTCCCT GTTCCCTTTT CGATTCGATT GGATTGGATT GTTTTGCTGG CTCGCTCTCT CTCTCTCTCT CGTGGTGTGG
TGTGGACAAG AAAGGAAGGA AAGATGGAGG GCGGCGTAGG GGGGGAGGTG GACCACCTCG CCGGCGAGAG GGCCACCGCG
CAGTTCGACG TTGAACACAT GAAGGTTGCC TGGGCTGGCT CCCGCCACGC CGTCGATGTC GCCGACCGCA TGGCGCGCCT
CGTCGCTTCC GACCCCGTAA CAATAACTTT CTCCCTCTTT CTTTCTTTCT TTGCACAGAT AGATAGATAG ATTATCAACT
TCGGCTCCCC GGATCTCTGA TTAAATTACC TGTATGATGC TCTTCTTCTC TTCCCCCAAT CCTTCTTTCC TTGTTCTTCA
ACAACCACAC CACGCCGGCC CGATTTTACC CCACGATAAT AAT

Locus: Os06g0103500

Loading...

Locus: Os06g0103500

Loading...