Os06t0103500-04

Locus

Os06g0103500

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ACX1, OsACX1

Oryzabase Gene Name Synonym(s)

acyl-CoA oxidase 1

Transcript Evidence

AK104349 (DDBJ, Best hit)

AK059993 (DDBJ, Best hit)

Protein Evidence

E9L0E1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: fatty acid beta-oxidation (GO:0006635)

Biological Process: oxidation-reduction process (GO:0055114)

Cellular Component: peroxisome (GO:0005777)

Molecular Function: acyl-CoA oxidase activity (GO:0003997)

Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

Functional domain (InterPro)

Acyl-CoA oxidase, C-terminal (IPR002655)

Acyl-CoA dehydrogenase/oxidase C-terminal (IPR009075)

Acyl-CoA oxidase, peroxisomal (IPR023570)

Full-length cDNA

001-034-F12 (Online Clone Ordering)

006-301-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0103500-04)

RiceXPro (AK104349)

Others

Oryzabase (22011)

KEGG (Os06t0103500-04 (EC:1.3.3.6))

Transcript

1045 bp

>Os06t0103500-04 Similar to predicted protein.
TGCTATCTATGTTCCTGCTTGCACTTATGAAGGAGACAATGTTGTTTTGCTATTGCAGGT
TGCAAGGTTTCTAATGAAGACTGTATCCCAGTTAGCTTCTGGAAAACAGCCTGTTGGTAC
AACGGCTTACATGGGCAACATACAGTACTTGATGCAATGCAAATGTGGTGTAAATACAGC
TGAAGATTGGCTAAATCCTGCTGCCATACGAGAGGTATTTGAAGCTCGGGCTCTCAGGAT
GGCGGTGAATTGTGCCCAGAACATAAACAAGGCGCCAAGCCAAGAAGAAGGGTTTTATGA
GCTATCCCCTGATCTGCTTGAGGTGGCGGTGGCCCATATCCAGTTGATAATTGTAACCAA
GTTCATAGAGAAATTAGAGCAGGACATCCCTGGTGAGGGAGTGAAGGAGCAACTGTGCAT
CCTTTGCAATGTGTACGCGCTGTATCTTGTTCACAAGCATCTGGGTGACTTCCTGTCGAC
GGGGAGCATCACAGCAAGGCAGGGAGCGCTGGCAAACGAGCAGCTGGGAAAGCTGTATGC
GCAGGTGCGGCCGAACGCGGTGGCGCTGGTGGACGCGTTCAACTACACCGACCACTACCT
GGGGTCGGTGCTGGGGCGCTACGACGGCAATGTTTACCCGGCGCTGTACGAGGAGGCGTG
GAAGGACCCCCTCAACGACACGGATGTGCCGGACGGTTACCAGGAGCACCTCCGCCCTCT
GCTCAAGCAGCAGCTCAAGCTCTCCAGGCTATGATCATCCATCCATCATCCTCCCTTTCT
TGCTCTATCAATCATATCATACTGCATACGATTTGAGTAGTAGTAAAATAACACCAGCAT
ATGCAAGGTGCTGGCTGGCTGCTAGTATTTTCTTTTTCTTTATAATTTATTTATTTGGGG
AGAGCTGGTATTGTCTTATTTATTTGGGAAGAGCTGGTATTGTATGTCTGGTGATTTGGT
ATAGCTGTAACTGTGAACTTCACCACATCTCCCCCTTCTCAAGGGCATATGCATTCTACT
CCTATggctgtgtttagttccttcc

CDS

753 bp

>Os06t0103500-04 Similar to predicted protein.
GCTATCTATGTTCCTGCTTGCACTTATGAAGGAGACAATGTTGTTTTGCTATTGCAGGTT
GCAAGGTTTCTAATGAAGACTGTATCCCAGTTAGCTTCTGGAAAACAGCCTGTTGGTACA
ACGGCTTACATGGGCAACATACAGTACTTGATGCAATGCAAATGTGGTGTAAATACAGCT
GAAGATTGGCTAAATCCTGCTGCCATACGAGAGGTATTTGAAGCTCGGGCTCTCAGGATG
GCGGTGAATTGTGCCCAGAACATAAACAAGGCGCCAAGCCAAGAAGAAGGGTTTTATGAG
CTATCCCCTGATCTGCTTGAGGTGGCGGTGGCCCATATCCAGTTGATAATTGTAACCAAG
TTCATAGAGAAATTAGAGCAGGACATCCCTGGTGAGGGAGTGAAGGAGCAACTGTGCATC
CTTTGCAATGTGTACGCGCTGTATCTTGTTCACAAGCATCTGGGTGACTTCCTGTCGACG
GGGAGCATCACAGCAAGGCAGGGAGCGCTGGCAAACGAGCAGCTGGGAAAGCTGTATGCG
CAGGTGCGGCCGAACGCGGTGGCGCTGGTGGACGCGTTCAACTACACCGACCACTACCTG
GGGTCGGTGCTGGGGCGCTACGACGGCAATGTTTACCCGGCGCTGTACGAGGAGGCGTGG
AAGGACCCCCTCAACGACACGGATGTGCCGGACGGTTACCAGGAGCACCTCCGCCCTCTG
CTCAAGCAGCAGCTCAAGCTCTCCAGGCTATGA

Protein

251 aa

>Os06t0103500-04 Similar to predicted protein.
AIYVPACTYEGDNVVLLLQVARFLMKTVSQLASGKQPVGTTAYMGNIQYLMQCKCGVNTA
EDWLNPAAIREVFEARALRMAVNCAQNINKAPSQEEGFYELSPDLLEVAVAHIQLIIVTK
FIEKLEQDIPGEGVKEQLCILCNVYALYLVHKHLGDFLSTGSITARQGALANEQLGKLYA
QVRPNAVALVDAFNYTDHYLGSVLGRYDGNVYPALYEEAWKDPLNDTDVPDGYQEHLRPL
LKQQLKLSRL*

5'UTR

chr06:230961..230961 (+ strand) : 1 bp

CDS

chr06:230962..231018 (+ strand) : 57 bp

chr06:231182..231302 (+ strand) : 121 bp

chr06:231453..231563 (+ strand) : 111 bp

chr06:231710..231779 (+ strand) : 70 bp

chr06:231880..232063 (+ strand) : 184 bp

chr06:232137..232346 (+ strand) : 210 bp

3'UTR

chr06:232347..232637 (+ strand) : 291 bp

FASTA

>Os06t0103500-04 class=Sequence position=chr06:230961..232637 (+ strand)
TGCTATCTAT GTTCCTGCTT GCACTTATGA AGGAGACAAT GTTGTTTTGC TATTGCAGGT TAGTATGCTA TTGTTGTTTT
GTTCTGTGGA TACTAATAAC TCTCCTACCT GCTTGTGGTT GTGTGGATGG CCTAGCTTGT TGGGCCGAAT CATAGGTCCA
GTCCTTCAAG TTTCCTCAGT TTTGGTCAAT TTACAGTCAT AACCTTTGGT GCTCTCTGCA GGTTGCAAGG TTTCTAATGA
AGACTGTATC CCAGTTAGCT TCTGGAAAAC AGCCTGTTGG TACAACGGCT TACATGGGCA ACATACAGTA CTTGATGCAA
TGCAAATGTG GTGTAAATAC AGGTATATAG TTGTATCTTC TGGCAGGCTC CTGTTTTAGA CAGCTGTATG CCAGTCATCA
CTGTACGTTA TGTATATATA TGCCCATTGC TGGGAAGCCA TTGATGTTGA GATGAATGCC ATAGTGATTC ATTTTTCCAT
GATTATCGAC AGCTGAAGAT TGGCTAAATC CTGCTGCCAT ACGAGAGGTA TTTGAAGCTC GGGCTCTCAG GATGGCGGTG
AATTGTGCCC AGAACATAAA CAAGGCGCCA AGCCAAGAAG AAGGTTGGTA TTGCGCCATA TGATTATTAA TCGAGAATAA
AATATAGAAC AGAAACCATA GTGCATTTGC ATGTAGTTTC GTATTAATTT CCGTGGTCTA TTATAAGAAA TTGCATAGAT
GATGATGGTG TGCGTTGCTG AATATGCAGG GTTTTATGAG CTATCCCCTG ATCTGCTTGA GGTGGCGGTG GCCCATATCC
AGTTGATAAT TGTAACCAAG TGAGTATTGC CTAGGATGAA AGAAATCTGA AGTATGGCTT CATTTATATT TTATTGGCAT
TTATTTATTT CGGTGTGTTA TGGTACGTAT AATGGTTAGG TTCATAGAGA AATTAGAGCA GGACATCCCT GGTGAGGGAG
TGAAGGAGCA ACTGTGCATC CTTTGCAATG TGTACGCGCT GTATCTTGTT CACAAGCATC TGGGTGACTT CCTGTCGACG
GGGAGCATCA CAGCAAGGCA GGGAGCGCTG GCAAACGAGC AGCTGGGAAA GCTGTATGCG CAGGTATGGT GTCCTCCGTC
GATGTCAATG TCAAAAGTGG ATGAGAAACT GAGAAATGAG ACAAATGCAA ATGCAGGTGC GGCCGAACGC GGTGGCGCTG
GTGGACGCGT TCAACTACAC CGACCACTAC CTGGGGTCGG TGCTGGGGCG CTACGACGGC AATGTTTACC CGGCGCTGTA
CGAGGAGGCG TGGAAGGACC CCCTCAACGA CACGGATGTG CCGGACGGTT ACCAGGAGCA CCTCCGCCCT CTGCTCAAGC
AGCAGCTCAA GCTCTCCAGG CTATGATCAT CCATCCATCA TCCTCCCTTT CTTGCTCTAT CAATCATATC ATACTGCATA
CGATTTGAGT AGTAGTAAAA TAACACCAGC ATATGCAAGG TGCTGGCTGG CTGCTAGTAT TTTCTTTTTC TTTATAATTT
ATTTATTTGG GGAGAGCTGG TATTGTCTTA TTTATTTGGG AAGAGCTGGT ATTGTATGTC TGGTGATTTG GTATAGCTGT
AACTGTGAAC TTCACCACAT CTCCCCCTTC TCAAGGGCAT ATGCATTCTA CTCCTATggc tgtgtttagt tccttcc

Locus: Os06g0103500

Loading...

Locus: Os06g0103500

Loading...