Os06t0108900-01

Locus

Os06g0108900

Description

Similar to H0613A10.3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

BEL1, OsBEL, BEL

Oryzabase Gene Name Synonym(s)

bell-like homeodomain protein, BELL1 homolog

Transcript Evidence

AK111490 (DDBJ, Best hit)

Protein Evidence

Q25A58 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J013000A19 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0108900-01)

Others

Oryzabase (19689)

Transcript

4819 bp

>Os06t0108900-01 Similar to H0613A10.3 protein.
AGTAGTACCATGGTTTAATTATTTGTAGCCTTATAGAGAGAGAGAAGAGAAGAAGAGAGA
GAGATCAGTGTGAGGCACCGACGAAGACGAAGACGAAGACGACGACGACGACAAGCACAC
AACAAATTTGCACACACGCGCGCGAGCATCGATGATGGCGGCCCATCATCATCATCATGA
GCACCACCACCTCTTGGACATGTCGTcgcccccaaacgccagcggcgccatcatctcctc
cttcgaccacgccgccggcctcctctccctccacgacgtcgccgccgccgccgaccacca
ccaccaccaccTACGAGGAGGAGGAGGGGGTTTGCAATTGCCATCGCCGTGGTCGCAGCA
GCAGGTTTCCCTCTCCCTCTACAACAACGCTGCCGGCGCAGCAGGCTCGCCGCCGTCGTC
GTTGGTTGCCCATCAGCAGCTGGCGGCGGCGCAGCCATTAATGTTCCAGCTGAGGGGGTC
CAAGTACCTGGGCCCTGTGAAGGCGCTGCTCGCCGAGTTCTGCAGCCTCGACGTTGAGGC
CATGGATGGCGCCAAGCAGCAGAGACCTCCCAATCCCAATCCCAAGATTGGAAAGTGGGA
CGACGTGGAGGGTTCAGGTTCGTGGGGCAACCTGTCTCTGAGCTCCATGGACCTCCTGGA
TCTCGAGAGGAGGAAGGCCAGGATCTTGTCCATGGTTGAAGAGGTAATTAATTAACAGCT
TCTTCTCTTTCTTTCTTTCTTTTTTTTTTCATTTTTTTCCTTTTTTGAGATCAAGGTAAT
AGCTAGTCTAATCGCACACACGCATGCATCTTTCAGTTTTTTATTTCCTTTTCTTTTCTC
ACTTCAGTACTTCTACTAGTAATTAACAGTGCTAGCTAGCTGTCCTTAGTCTTTTACTAC
TTATGTTAATTTTCACTCGTTCCTTTTTTTACCGAAATTTTCACTTGTTCCGATCCTCCT
TCACTGTCCTGGCTACTTTTACCTTTTCTATGCAAGTATATACAAAATAGTTTTGGGACA
ATTGCTTATTAACTACCACTCGATCGATCTCTGTCCTTTCACATATAATTACAGTTTTTT
TTTTAAAAAAAACAAACCTACAGGAGAGAACTGCCCAATTAATTAATTGTATTAAAGTTG
AAGTAAAAACCTAGATAAGTTAAAAAGAAAAGAGCATACTTTTTCATGCAGTTCGTTGAC
TAATTTGTTTCTGGCAACTATTTAGCTAGAAAACTTTGTTAATTAGTTTTCGTCTGTGAA
TTGAGCAAGCTCAACATGGTTAAGTAGCTAGTTTTGTGGAAAGCGGTGAGTACTTACTCA
CGCCAAGCTTTGATATATTCATGGATGCAATCAGTACATGCATGTCACATTGGCAACAGT
GGGAGAGCTAGTGATATATACATGTACACACCATCACTAAATATGTGGATTATATACGTG
TGTCCTTCATGCTTTCCCAAGCTCCTTTTTCGGTCATATATATTTATATTTATATGTCAC
CTTTTAAGGCCATCTTTTTTTAAGGGAAACATCAATAAAAGTACTATGACAGGCtgtcac
gccccgaactagtcccgaccggaactagcccgtgacgctccaaattaacctgttaatcga
taccagtcccaggaaacagtgctggtatcacaggaagacagaatatcacagcaacagagg
tctctttattatagagtagaggtacagtcatgttgggctgcggacagatcccgagctcac
aactgcattacaaaaaggaaagcggaagccaagacttggaccaaacaacacagtcgcgac
ttgggaactaggccgaaaccctaaaactcatcgtagccggcttgctcctggaagaactcc
ttgtcagcgggatccgcttcatcttcttcagcaactgggggggattatttatatagagca
agggtgagtacgggagtactcagcaagccatgggaaataagtgtttaatgcaggcttcaa
ggaaaggctgttgtttttgcaattgattttatttgaactcttttctgaaaacaactaagt
gagtgcttctcaaacgacacggatgagacagtgcgtctcgtctggtcggagtatgtgcaa
tgtatcagtctttagaattgatcaagattggcacccggccaacaactttcaaacggccac
ccgggccaacaactttcaaacggccacccgggcctagctgatcccatcagctgcagattt
tccaaacatcgatccccttttcacaacagcaatttcacaaggagtagtcaaacaaaacta
cgctaggaatcacctcacatccgcccatgaccgtgggcacggctgttcgaacagtttgtt
aacctctgcagagggggtacattttacccacacgacattactaacccggatcacccagcc
tgtggggatcagccacgtcgggagacctccaagctttcatgacaaggcattttcaaagcc
gacacaggtttaccatatgccgacgagaggggtcccagaccaacaacaggttaggtccca
gaccatactgtgccaggaagcccaggggtcctccccgacaccaccccggcgaatccacat
gtctctcggcatcaaggctcccctgataagctagttactcagccaggggtgtcccattcc
acccatgtggtcgtacttgtcttatgttcggatgaaattctaaggaaacggtccttaagt
gcaagagcgggaaaccgtacacccggtacgttccccggtccgcggttttggaaatttatt
tagttcgcaagcaccgacccaggtgtcgggttttccaagtcttttgtaaaacccaagttt
tacccaagttgtttttcagattttaagtttgaaggcgaccgtcgatactcgtgcagagtg
cacgatttccgaggcgcaactgggtggttacaagggaacatggtataacaattaacaaag
gaaggatcaaatgcaacaaactaggtaggtccgccaatctgccttgcagacgggacaaac
agattaagtgcgatcctatcaatgcataatatttttcaagcaacataattaagctcaaat
ataggctcaagatgttcaaaggtggcttgccttgctcgagatcttgagcttgatcctcga
aatcctcgcattgcgggtcttcgggctccgaaactacgcgcaaaacgggacaactcaaca
aatggtgaaaataaagccctattaatgacctctaagcgtgccattagatagatctcgaga
tttgaggaattttggaagttgaacggagtcaaacggacttacggttgggaagatattgaa
tttctaagattattggatttttggtctaaaggaaaaggatttaattaaatccttttggaa
aaagaaaaggaagagggaggggaattaaacttccctcgggcggctagggcgcggcccgag
agaaaaggggcggctcggccgagctaaatgggccggccggcccaaaaggcggcccagagc
gcgcgcgggaggggaggagagagggagccggtggaccgggctcacctcgcgtggtcctgg
gtgggacccgcttgtcagcagctcggctcaccgtgcggaggaagcacgcggcgcggcgct
agggtgtggagcggggcgcggcgcatgcgcgcggttcatggtggacgcggatgcggcggg
cccacgcgcagcctcacggcttgcggtggactgcgcccgcgagcggggccggagggagcg
gctgaccggggtcggctcgacccagtcttggccgagctggcgccgacgtggcgcctacgt
ggcagccacgcgggccgacgggaggttgaagaagacgccggccggaacggacggcggacg
gcggtggcgagcggcggagcgaaacacggcgatctaggcgaaagcgagcacaccgggaag
ttgcgcgggacgaggggagtcgagccaacggctcggatttgccgggggatgctcgacggc
ggcggattgcggcggcggcaaccggcggcggaagaagggggaaacggcgacaaggtcacg
aggggccgattcccggcggcgagagcatctacgcggctacgggaatctgtccctagcgtc
ggattaggaggaaacgcatcgagggaggccggcgacgagaggcgcttccgagctcgggcg
gcgacggcggcgagcacatggcgagcggcggcaacgagcgagggcagtggggccaggcgg
cgcggacggcgcaggcgcggcacgggcgacgaccacgcgggcgcgtgcacgcgaacaacg
gcacgcgggggccgagtcggagggctcggctcggcgcctcgcacgcgcgcgcggtgcgcg
ggcagagcggagagagagagagagggagagagagagagagccggggagggagggggaaga
tgggccaagagggattcggcccatcgaacccgagggaggcaaaatagacttttgcgaagg
gattgatttgggaaggatttggattcgggattgaactcgacgatagatcggggatttgag
atatgagaaggcacggacactagacaacaagcaaagaaacagatttcgcaaaaagggttt
ttaagagatagttttcccgctaggcgccacggcggaacgggcgctacacaggctttcgca
aacattttgtaagttaaaaaaaaaaagaaaacaacacacaaattactcaaattattaata
attaacataagatagaatgcatgaaCTTGTAAATATATATGTGCATAAATGGATTTTACA
ACttcttaaatatcaatcaaacagttgtaaaaagacctaaaaattgtaacattgataaag
taagtatccatcgtcgtgc

CDS

417 bp

>Os06t0108900-01 Similar to H0613A10.3 protein.
ctgatcccatcagctgcagattttccaaacatcgatccccttttcacaacagcaatttca
caaggagtagtcaaacaaaactacgctaggaatcacctcacatccgcccatgaccgtggg
cacggctgttcgaacagtttgttaacctctgcagagggggtacattttacccacacgaca
ttactaacccggatcacccagcctgtggggatcagccacgtcgggagacctccaagcttt
catgacaaggcattttcaaagccgacacaggtttaccatatgccgacgagaggggtccca
gaccaacaacaggttaggtcccagaccatactgtgccaggaagcccaggggtcctccccg
acaccaccccggcgaatccacatgtctctcggcatcaaggctcccctgataagctag

Protein

139 aa

>Os06t0108900-01 Similar to H0613A10.3 protein.
LIPSAADFPNIDPLFTTAISQGVVKQNYARNHLTSAHDRGHGCSNSLLTSAEGVHFTHTT
LLTRITQPVGISHVGRPPSFHDKAFSKPTQVYHMPTRGVPDQQQVRSQTILCQEAQGSSP
TPPRRIHMSLGIKAPLIS*

5'UTR

chr06:523053..525249 (+ strand) : 2197 bp

CDS

chr06:525250..525666 (+ strand) : 417 bp

3'UTR

chr06:525667..527871 (+ strand) : 2205 bp

FASTA

>Os06t0108900-01 class=Sequence position=chr06:523053..527871 (+ strand)
AGTAGTACCA TGGTTTAATT ATTTGTAGCC TTATAGAGAG AGAGAAGAGA AGAAGAGAGA GAGATCAGTG TGAGGCACCG
ACGAAGACGA AGACGAAGAC GACGACGACG ACAAGCACAC AACAAATTTG CACACACGCG CGCGAGCATC GATGATGGCG
GCCCATCATC ATCATCATGA GCACCACCAC CTCTTGGACA TGTCGTcgcc cccaaacgcc agcggcgcca tcatctcctc
cttcgaccac gccgccggcc tcctctccct ccacgacgtc gccgccgccg ccgaccacca ccaccaccac cTACGAGGAG
GAGGAGGGGG TTTGCAATTG CCATCGCCGT GGTCGCAGCA GCAGGTTTCC CTCTCCCTCT ACAACAACGC TGCCGGCGCA
GCAGGCTCGC CGCCGTCGTC GTTGGTTGCC CATCAGCAGC TGGCGGCGGC GCAGCCATTA ATGTTCCAGC TGAGGGGGTC
CAAGTACCTG GGCCCTGTGA AGGCGCTGCT CGCCGAGTTC TGCAGCCTCG ACGTTGAGGC CATGGATGGC GCCAAGCAGC
AGAGACCTCC CAATCCCAAT CCCAAGATTG GAAAGTGGGA CGACGTGGAG GGTTCAGGTT CGTGGGGCAA CCTGTCTCTG
AGCTCCATGG ACCTCCTGGA TCTCGAGAGG AGGAAGGCCA GGATCTTGTC CATGGTTGAA GAGGTAATTA ATTAACAGCT
TCTTCTCTTT CTTTCTTTCT TTTTTTTTTC ATTTTTTTCC TTTTTTGAGA TCAAGGTAAT AGCTAGTCTA ATCGCACACA
CGCATGCATC TTTCAGTTTT TTATTTCCTT TTCTTTTCTC ACTTCAGTAC TTCTACTAGT AATTAACAGT GCTAGCTAGC
TGTCCTTAGT CTTTTACTAC TTATGTTAAT TTTCACTCGT TCCTTTTTTT ACCGAAATTT TCACTTGTTC CGATCCTCCT
TCACTGTCCT GGCTACTTTT ACCTTTTCTA TGCAAGTATA TACAAAATAG TTTTGGGACA ATTGCTTATT AACTACCACT
CGATCGATCT CTGTCCTTTC ACATATAATT ACAGTTTTTT TTTTAAAAAA AACAAACCTA CAGGAGAGAA CTGCCCAATT
AATTAATTGT ATTAAAGTTG AAGTAAAAAC CTAGATAAGT TAAAAAGAAA AGAGCATACT TTTTCATGCA GTTCGTTGAC
TAATTTGTTT CTGGCAACTA TTTAGCTAGA AAACTTTGTT AATTAGTTTT CGTCTGTGAA TTGAGCAAGC TCAACATGGT
TAAGTAGCTA GTTTTGTGGA AAGCGGTGAG TACTTACTCA CGCCAAGCTT TGATATATTC ATGGATGCAA TCAGTACATG
CATGTCACAT TGGCAACAGT GGGAGAGCTA GTGATATATA CATGTACACA CCATCACTAA ATATGTGGAT TATATACGTG
TGTCCTTCAT GCTTTCCCAA GCTCCTTTTT CGGTCATATA TATTTATATT TATATGTCAC CTTTTAAGGC CATCTTTTTT
TAAGGGAAAC ATCAATAAAA GTACTATGAC AGGCtgtcac gccccgaact agtcccgacc ggaactagcc cgtgacgctc
caaattaacc tgttaatcga taccagtccc aggaaacagt gctggtatca caggaagaca gaatatcaca gcaacagagg
tctctttatt atagagtaga ggtacagtca tgttgggctg cggacagatc ccgagctcac aactgcatta caaaaaggaa
agcggaagcc aagacttgga ccaaacaaca cagtcgcgac ttgggaacta ggccgaaacc ctaaaactca tcgtagccgg
cttgctcctg gaagaactcc ttgtcagcgg gatccgcttc atcttcttca gcaactgggg gggattattt atatagagca
agggtgagta cgggagtact cagcaagcca tgggaaataa gtgtttaatg caggcttcaa ggaaaggctg ttgtttttgc
aattgatttt atttgaactc ttttctgaaa acaactaagt gagtgcttct caaacgacac ggatgagaca gtgcgtctcg
tctggtcgga gtatgtgcaa tgtatcagtc tttagaattg atcaagattg gcacccggcc aacaactttc aaacggccac
ccgggccaac aactttcaaa cggccacccg ggcctagctg atcccatcag ctgcagattt tccaaacatc gatccccttt
tcacaacagc aatttcacaa ggagtagtca aacaaaacta cgctaggaat cacctcacat ccgcccatga ccgtgggcac
ggctgttcga acagtttgtt aacctctgca gagggggtac attttaccca cacgacatta ctaacccgga tcacccagcc
tgtggggatc agccacgtcg ggagacctcc aagctttcat gacaaggcat tttcaaagcc gacacaggtt taccatatgc
cgacgagagg ggtcccagac caacaacagg ttaggtccca gaccatactg tgccaggaag cccaggggtc ctccccgaca
ccaccccggc gaatccacat gtctctcggc atcaaggctc ccctgataag ctagttactc agccaggggt gtcccattcc
acccatgtgg tcgtacttgt cttatgttcg gatgaaattc taaggaaacg gtccttaagt gcaagagcgg gaaaccgtac
acccggtacg ttccccggtc cgcggttttg gaaatttatt tagttcgcaa gcaccgaccc aggtgtcggg ttttccaagt
cttttgtaaa acccaagttt tacccaagtt gtttttcaga ttttaagttt gaaggcgacc gtcgatactc gtgcagagtg
cacgatttcc gaggcgcaac tgggtggtta caagggaaca tggtataaca attaacaaag gaaggatcaa atgcaacaaa
ctaggtaggt ccgccaatct gccttgcaga cgggacaaac agattaagtg cgatcctatc aatgcataat atttttcaag
caacataatt aagctcaaat ataggctcaa gatgttcaaa ggtggcttgc cttgctcgag atcttgagct tgatcctcga
aatcctcgca ttgcgggtct tcgggctccg aaactacgcg caaaacggga caactcaaca aatggtgaaa ataaagccct
attaatgacc tctaagcgtg ccattagata gatctcgaga tttgaggaat tttggaagtt gaacggagtc aaacggactt
acggttggga agatattgaa tttctaagat tattggattt ttggtctaaa ggaaaaggat ttaattaaat ccttttggaa
aaagaaaagg aagagggagg ggaattaaac ttccctcggg cggctagggc gcggcccgag agaaaagggg cggctcggcc
gagctaaatg ggccggccgg cccaaaaggc ggcccagagc gcgcgcggga ggggaggaga gagggagccg gtggaccggg
ctcacctcgc gtggtcctgg gtgggacccg cttgtcagca gctcggctca ccgtgcggag gaagcacgcg gcgcggcgct
agggtgtgga gcggggcgcg gcgcatgcgc gcggttcatg gtggacgcgg atgcggcggg cccacgcgca gcctcacggc
ttgcggtgga ctgcgcccgc gagcggggcc ggagggagcg gctgaccggg gtcggctcga cccagtcttg gccgagctgg
cgccgacgtg gcgcctacgt ggcagccacg cgggccgacg ggaggttgaa gaagacgccg gccggaacgg acggcggacg
gcggtggcga gcggcggagc gaaacacggc gatctaggcg aaagcgagca caccgggaag ttgcgcggga cgaggggagt
cgagccaacg gctcggattt gccgggggat gctcgacggc ggcggattgc ggcggcggca accggcggcg gaagaagggg
gaaacggcga caaggtcacg aggggccgat tcccggcggc gagagcatct acgcggctac gggaatctgt ccctagcgtc
ggattaggag gaaacgcatc gagggaggcc ggcgacgaga ggcgcttccg agctcgggcg gcgacggcgg cgagcacatg
gcgagcggcg gcaacgagcg agggcagtgg ggccaggcgg cgcggacggc gcaggcgcgg cacgggcgac gaccacgcgg
gcgcgtgcac gcgaacaacg gcacgcgggg gccgagtcgg agggctcggc tcggcgcctc gcacgcgcgc gcggtgcgcg
ggcagagcgg agagagagag agagggagag agagagagag ccggggaggg agggggaaga tgggccaaga gggattcggc
ccatcgaacc cgagggaggc aaaatagact tttgcgaagg gattgatttg ggaaggattt ggattcggga ttgaactcga
cgatagatcg gggatttgag atatgagaag gcacggacac tagacaacaa gcaaagaaac agatttcgca aaaagggttt
ttaagagata gttttcccgc taggcgccac ggcggaacgg gcgctacaca ggctttcgca aacattttgt aagttaaaaa
aaaaaagaaa acaacacaca aattactcaa attattaata attaacataa gatagaatgc atgaaCTTGT AAATATATAT
GTGCATAAAT GGATTTTACA ACttcttaaa tatcaatcaa acagttgtaa aaagacctaa aaattgtaac attgataaag
taagtatcca tcgtcgtgc

Locus: Os06g0108900

Loading...

Locus: Os06g0108900

Loading...