Os06t0108900-02

Locus

Os06g0108900

Description

Homeodomain-related domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

BEL1, OsBEL, BEL

Oryzabase Gene Name Synonym(s)

bell-like homeodomain protein, BELL1 homolog

Transcript Evidence

AK101029 (DDBJ, Best hit)

Protein Evidence

B2ZTC6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox (IPR001356)

POX (IPR006563)

Homeobox KN domain (IPR008422)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Full-length cDNA

J023150H24 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0108900-02)

RiceXPro (AK101029)

Others

Oryzabase (19689)

KEGG (Os06t0108900-02)

Transcript

2110 bp

>Os06t0108900-02 Homeodomain-related domain containing protein.
CCATGGTTTAATTATTTGTAGCCTTATAGAGAGAGAGAAGAGAAGAAGAGAGAGAGATCA
GTGTGAGGCACCGACGAAGACGAAGACGAAGACGACGACGACGACAAGCACACAACAAAT
TTGCACACACGCGCGCGAGCATCGATGATGGCGGCCCATCATCATCATCATGAGCACCAC
CACCTCTTGGACATGTCGTcgcccccaaacgccagcggcgccatcatctcctccttcgac
cacgccgccggcctcctctccctccacgacgtcgccgccgccgccgaccaccaccaccac
caccTACGAGGAGGAGGAGGGGGTTTGCAATTGCCATCGCCGTGGTCGCAGCAGCAGGTT
TCCCTCTCCCTCTACAACAACGCTGCCGGCGCAGCAGGCTCGCCGCCGTCGTCGTTGGTT
GCCCATCAGCAGCTGGCGGCGGCGCAGCCATTAATGTTCCAGCTGAGGGGGTCCAAGTAC
CTGGGCCCTGTGAAGGCGCTGCTCGCCGAGTTCTGCAGCCTCGACGTTGAGGCCATGGAT
GGCGCCAAGCAGCAGAGACCTCCCAATCCCAATCCCAAGATTGGAAAGTGGGACGACGTG
GAGGGTTCAGGTTCGTGGGGCAACCTGTCTCTGAGCTCCATGGACCTCCTGGATCTCGAG
AGGAGGAAGGCCAGGATCTTGTCCATGGTTGAAGAGGTGGACAGACGTTACCGGCGATAC
CGTGAGCAGATGAGGGCGGTGGAGGTGTCGTTCGAGGCGGTGGCCGGCGGCGGCGCGGCG
CAGGTGTACACGAAGCTGGCGATGCGAGCCATGTCGCGGCACTTCCGGTGCCTGAGGGAC
GCGCTGGTGGGGCAGGTGCGCGCGCTGAGGAACGCCATGGGGGAGAGCCAGAGGGACGCC
GCCGGCGGCGTGGCGGCGGCGGCGCCCGGTGCCACCAAGGGCGACACGCCTCGGCTGCGG
GTGCTGGACCAGTGCCTGAGGCAGCAGAGGGCGTTCCAGCAGTCCGGCGccgtcgacagc
ttcccgtggcgcccgcagcgcggtctgccggagcgcgccgtcgccgtcctccgcgcctgg
ctcttcgagcacttcctccacccGTATCCAAATGATGTGGACAAGCACATTTTGGCGCGC
CAAACAGGCTTGTCAAGAAGCCAGGTTTCGAATTGGTTCATCAATGCAAGGGTGAGGCTA
TGGAAGCCTATGATAGAAGACATGTACAAGGAAGAAACGAAGCCGGAATCATCTGATGGC
AACAACAAATTAAACCCTAGCGCAGCCGGCAACAAACAGCAGCATCGAGATGATCCCAAG
AAGAATTACACGGCAACGACAGCAGAAGCCAGCTTAGTACAACAAAGCAGCTACCATCTC
CACCTTCGCAGCAGCGGAAACCGTAACTCCTCCTCGTTGATGATCCCTGCAGCAGCATCA
ACATCCATCGATCATCACCATGACAGCAGCCACCAGCTGTTGGGCGGCCATAGCTATTCT
TCAGCAGCAGGATTGCATCATGGTCATGGCGGCGCCGTGTCGCTTACTCTAGGGCTCCAG
CAGCAGCAGCAGCCATTTGCGGCGTCGATGATGCATCAGCATCAGCAGCACCAGCACCAG
CACCAGCAGCAGCAGTCATTCATGGTGGAGGCGGCGGAGGAAGAAGAAGATGACGTGCTC
CCTTACAGGAACCTCATGGAGTCTCAGTTGCTGCATGATTTTGCAGGAGCTAGCTAAGGC
AGGCTCCAGCTTAGCATGCAGCTAATTTATTTGATTGTTAAAGGAGATTATTGCGCTCAA
AAGTTTAATTTAATTAAGGAGATGTAGGTAATTAAATATTACATTATTGTTCTTTTATGA
CCAAACATTTCGTTACATTATTTGGGGATTTCTTTTGTAAAAATCAGCCCACCACTTCTG
TTCTGGCCTAGCTAGCTTAGCATGCAGTGATGTGGAACCCACCCTTGCAATCCCATCTGG
GCCCATGACAAGTTAGTTACTTAgagcacccgcaatggtaaagtaaggtgttatctataa
aacatgtacatctcagcaatagactagattaatagtaaaccacttcaatggtatgtctac
atgggtatct

CDS

1593 bp

>Os06t0108900-02 Homeodomain-related domain containing protein.
ATGATGGCGGCCCATCATCATCATCATGAGCACCACCACCTCTTGGACATGTCGTcgccc
ccaaacgccagcggcgccatcatctcctccttcgaccacgccgccggcctcctctccctc
cacgacgtcgccgccgccgccgaccaccaccaccaccaccTACGAGGAGGAGGAGGGGGT
TTGCAATTGCCATCGCCGTGGTCGCAGCAGCAGGTTTCCCTCTCCCTCTACAACAACGCT
GCCGGCGCAGCAGGCTCGCCGCCGTCGTCGTTGGTTGCCCATCAGCAGCTGGCGGCGGCG
CAGCCATTAATGTTCCAGCTGAGGGGGTCCAAGTACCTGGGCCCTGTGAAGGCGCTGCTC
GCCGAGTTCTGCAGCCTCGACGTTGAGGCCATGGATGGCGCCAAGCAGCAGAGACCTCCC
AATCCCAATCCCAAGATTGGAAAGTGGGACGACGTGGAGGGTTCAGGTTCGTGGGGCAAC
CTGTCTCTGAGCTCCATGGACCTCCTGGATCTCGAGAGGAGGAAGGCCAGGATCTTGTCC
ATGGTTGAAGAGGTGGACAGACGTTACCGGCGATACCGTGAGCAGATGAGGGCGGTGGAG
GTGTCGTTCGAGGCGGTGGCCGGCGGCGGCGCGGCGCAGGTGTACACGAAGCTGGCGATG
CGAGCCATGTCGCGGCACTTCCGGTGCCTGAGGGACGCGCTGGTGGGGCAGGTGCGCGCG
CTGAGGAACGCCATGGGGGAGAGCCAGAGGGACGCCGCCGGCGGCGTGGCGGCGGCGGCG
CCCGGTGCCACCAAGGGCGACACGCCTCGGCTGCGGGTGCTGGACCAGTGCCTGAGGCAG
CAGAGGGCGTTCCAGCAGTCCGGCGccgtcgacagcttcccgtggcgcccgcagcgcggt
ctgccggagcgcgccgtcgccgtcctccgcgcctggctcttcgagcacttcctccacccG
TATCCAAATGATGTGGACAAGCACATTTTGGCGCGCCAAACAGGCTTGTCAAGAAGCCAG
GTTTCGAATTGGTTCATCAATGCAAGGGTGAGGCTATGGAAGCCTATGATAGAAGACATG
TACAAGGAAGAAACGAAGCCGGAATCATCTGATGGCAACAACAAATTAAACCCTAGCGCA
GCCGGCAACAAACAGCAGCATCGAGATGATCCCAAGAAGAATTACACGGCAACGACAGCA
GAAGCCAGCTTAGTACAACAAAGCAGCTACCATCTCCACCTTCGCAGCAGCGGAAACCGT
AACTCCTCCTCGTTGATGATCCCTGCAGCAGCATCAACATCCATCGATCATCACCATGAC
AGCAGCCACCAGCTGTTGGGCGGCCATAGCTATTCTTCAGCAGCAGGATTGCATCATGGT
CATGGCGGCGCCGTGTCGCTTACTCTAGGGCTCCAGCAGCAGCAGCAGCCATTTGCGGCG
TCGATGATGCATCAGCATCAGCAGCACCAGCACCAGCACCAGCAGCAGCAGTCATTCATG
GTGGAGGCGGCGGAGGAAGAAGAAGATGACGTGCTCCCTTACAGGAACCTCATGGAGTCT
CAGTTGCTGCATGATTTTGCAGGAGCTAGCTAA

Protein

531 aa

>Os06t0108900-02 Homeodomain-related domain containing protein.
MMAAHHHHHEHHHLLDMSSPPNASGAIISSFDHAAGLLSLHDVAAAADHHHHHLRGGGGG
LQLPSPWSQQQVSLSLYNNAAGAAGSPPSSLVAHQQLAAAQPLMFQLRGSKYLGPVKALL
AEFCSLDVEAMDGAKQQRPPNPNPKIGKWDDVEGSGSWGNLSLSSMDLLDLERRKARILS
MVEEVDRRYRRYREQMRAVEVSFEAVAGGGAAQVYTKLAMRAMSRHFRCLRDALVGQVRA
LRNAMGESQRDAAGGVAAAAPGATKGDTPRLRVLDQCLRQQRAFQQSGAVDSFPWRPQRG
LPERAVAVLRAWLFEHFLHPYPNDVDKHILARQTGLSRSQVSNWFINARVRLWKPMIEDM
YKEETKPESSDGNNKLNPSAAGNKQQHRDDPKKNYTATTAEASLVQQSSYHLHLRSSGNR
NSSSLMIPAAASTSIDHHHDSSHQLLGGHSYSSAAGLHHGHGGAVSLTLGLQQQQQPFAA
SMMHQHQQHQHQHQQQQSFMVEAAEEEEDDVLPYRNLMESQLLHDFAGAS*

5'UTR

chr06:523060..523203 (+ strand) : 144 bp

CDS

chr06:523204..523755 (+ strand) : 552 bp

chr06:528449..528855 (+ strand) : 407 bp

chr06:528956..529016 (+ strand) : 61 bp

chr06:529112..529684 (+ strand) : 573 bp

3'UTR

chr06:529685..530057 (+ strand) : 373 bp

FASTA

>Os06t0108900-02 class=Sequence position=chr06:523060..530057 (+ strand)
CCATGGTTTA ATTATTTGTA GCCTTATAGA GAGAGAGAAG AGAAGAAGAG AGAGAGATCA GTGTGAGGCA CCGACGAAGA
CGAAGACGAA GACGACGACG ACGACAAGCA CACAACAAAT TTGCACACAC GCGCGCGAGC ATCGATGATG GCGGCCCATC
ATCATCATCA TGAGCACCAC CACCTCTTGG ACATGTCGTc gcccccaaac gccagcggcg ccatcatctc ctccttcgac
cacgccgccg gcctcctctc cctccacgac gtcgccgccg ccgccgacca ccaccaccac caccTACGAG GAGGAGGAGG
GGGTTTGCAA TTGCCATCGC CGTGGTCGCA GCAGCAGGTT TCCCTCTCCC TCTACAACAA CGCTGCCGGC GCAGCAGGCT
CGCCGCCGTC GTCGTTGGTT GCCCATCAGC AGCTGGCGGC GGCGCAGCCA TTAATGTTCC AGCTGAGGGG GTCCAAGTAC
CTGGGCCCTG TGAAGGCGCT GCTCGCCGAG TTCTGCAGCC TCGACGTTGA GGCCATGGAT GGCGCCAAGC AGCAGAGACC
TCCCAATCCC AATCCCAAGA TTGGAAAGTG GGACGACGTG GAGGGTTCAG GTTCGTGGGG CAACCTGTCT CTGAGCTCCA
TGGACCTCCT GGATCTCGAG AGGAGGAAGG CCAGGATCTT GTCCATGGTT GAAGAGGTAA TTAATTAACA GCTTCTTCTC
TTTCTTTCTT TCTTTTTTTT TTCATTTTTT TCCTTTTTTG AGATCAAGGT AATAGCTAGT CTAATCGCAC ACACGCATGC
ATCTTTCAGT TTTTTATTTC CTTTTCTTTT CTCACTTCAG TACTTCTACT AGTAATTAAC AGTGCTAGCT AGCTGTCCTT
AGTCTTTTAC TACTTATGTT AATTTTCACT CGTTCCTTTT TTTACCGAAA TTTTCACTTG TTCCGATCCT CCTTCACTGT
CCTGGCTACT TTTACCTTTT CTATGCAAGT ATATACAAAA TAGTTTTGGG ACAATTGCTT ATTAACTACC ACTCGATCGA
TCTCTGTCCT TTCACATATA ATTACAGTTT TTTTTTTAAA AAAAACAAAC CTACAGGAGA GAACTGCCCA ATTAATTAAT
TGTATTAAAG TTGAAGTAAA AACCTAGATA AGTTAAAAAG AAAAGAGCAT ACTTTTTCAT GCAGTTCGTT GACTAATTTG
TTTCTGGCAA CTATTTAGCT AGAAAACTTT GTTAATTAGT TTTCGTCTGT GAATTGAGCA AGCTCAACAT GGTTAAGTAG
CTAGTTTTGT GGAAAGCGGT GAGTACTTAC TCACGCCAAG CTTTGATATA TTCATGGATG CAATCAGTAC ATGCATGTCA
CATTGGCAAC AGTGGGAGAG CTAGTGATAT ATACATGTAC ACACCATCAC TAAATATGTG GATTATATAC GTGTGTCCTT
CATGCTTTCC CAAGCTCCTT TTTCGGTCAT ATATATTTAT ATTTATATGT CACCTTTTAA GGCCATCTTT TTTTAAGGGA
AACATCAATA AAAGTACTAT GACAGGCtgt cacgccccga actagtcccg accggaacta gcccgtgacg ctccaaatta
acctgttaat cgataccagt cccaggaaac agtgctggta tcacaggaag acagaatatc acagcaacag aggtctcttt
attatagagt agaggtacag tcatgttggg ctgcggacag atcccgagct cacaactgca ttacaaaaag gaaagcggaa
gccaagactt ggaccaaaca acacagtcgc gacttgggaa ctaggccgaa accctaaaac tcatcgtagc cggcttgctc
ctggaagaac tccttgtcag cgggatccgc ttcatcttct tcagcaactg ggggggatta tttatataga gcaagggtga
gtacgggagt actcagcaag ccatgggaaa taagtgttta atgcaggctt caaggaaagg ctgttgtttt tgcaattgat
tttatttgaa ctcttttctg aaaacaacta agtgagtgct tctcaaacga cacggatgag acagtgcgtc tcgtctggtc
ggagtatgtg caatgtatca gtctttagaa ttgatcaaga ttggcacccg gccaacaact ttcaaacggc cacccgggcc
aacaactttc aaacggccac ccgggcctag ctgatcccat cagctgcaga ttttccaaac atcgatcccc ttttcacaac
agcaatttca caaggagtag tcaaacaaaa ctacgctagg aatcacctca catccgccca tgaccgtggg cacggctgtt
cgaacagttt gttaacctct gcagaggggg tacattttac ccacacgaca ttactaaccc ggatcaccca gcctgtgggg
atcagccacg tcgggagacc tccaagcttt catgacaagg cattttcaaa gccgacacag gtttaccata tgccgacgag
aggggtccca gaccaacaac aggttaggtc ccagaccata ctgtgccagg aagcccaggg gtcctccccg acaccacccc
ggcgaatcca catgtctctc ggcatcaagg ctcccctgat aagctagtta ctcagccagg ggtgtcccat tccacccatg
tggtcgtact tgtcttatgt tcggatgaaa ttctaaggaa acggtcctta agtgcaagag cgggaaaccg tacacccggt
acgttccccg gtccgcggtt ttggaaattt atttagttcg caagcaccga cccaggtgtc gggttttcca agtcttttgt
aaaacccaag ttttacccaa gttgtttttc agattttaag tttgaaggcg accgtcgata ctcgtgcaga gtgcacgatt
tccgaggcgc aactgggtgg ttacaaggga acatggtata acaattaaca aaggaaggat caaatgcaac aaactaggta
ggtccgccaa tctgccttgc agacgggaca aacagattaa gtgcgatcct atcaatgcat aatatttttc aagcaacata
attaagctca aatataggct caagatgttc aaaggtggct tgccttgctc gagatcttga gcttgatcct cgaaatcctc
gcattgcggg tcttcgggct ccgaaactac gcgcaaaacg ggacaactca acaaatggtg aaaataaagc cctattaatg
acctctaagc gtgccattag atagatctcg agatttgagg aattttggaa gttgaacgga gtcaaacgga cttacggttg
ggaagatatt gaatttctaa gattattgga tttttggtct aaaggaaaag gatttaatta aatccttttg gaaaaagaaa
aggaagaggg aggggaatta aacttccctc gggcggctag ggcgcggccc gagagaaaag gggcggctcg gccgagctaa
atgggccggc cggcccaaaa ggcggcccag agcgcgcgcg ggaggggagg agagagggag ccggtggacc gggctcacct
cgcgtggtcc tgggtgggac ccgcttgtca gcagctcggc tcaccgtgcg gaggaagcac gcggcgcggc gctagggtgt
ggagcggggc gcggcgcatg cgcgcggttc atggtggacg cggatgcggc gggcccacgc gcagcctcac ggcttgcggt
ggactgcgcc cgcgagcggg gccggaggga gcggctgacc ggggtcggct cgacccagtc ttggccgagc tggcgccgac
gtggcgccta cgtggcagcc acgcgggccg acgggaggtt gaagaagacg ccggccggaa cggacggcgg acggcggtgg
cgagcggcgg agcgaaacac ggcgatctag gcgaaagcga gcacaccggg aagttgcgcg ggacgagggg agtcgagcca
acggctcgga tttgccgggg gatgctcgac ggcggcggat tgcggcggcg gcaaccggcg gcggaagaag ggggaaacgg
cgacaaggtc acgaggggcc gattcccggc ggcgagagca tctacgcggc tacgggaatc tgtccctagc gtcggattag
gaggaaacgc atcgagggag gccggcgacg agaggcgctt ccgagctcgg gcggcgacgg cggcgagcac atggcgagcg
gcggcaacga gcgagggcag tggggccagg cggcgcggac ggcgcaggcg cggcacgggc gacgaccacg cgggcgcgtg
cacgcgaaca acggcacgcg ggggccgagt cggagggctc ggctcggcgc ctcgcacgcg cgcgcggtgc gcgggcagag
cggagagaga gagagaggga gagagagaga gagccgggga gggaggggga agatgggcca agagggattc ggcccatcga
acccgaggga ggcaaaatag acttttgcga agggattgat ttgggaagga tttggattcg ggattgaact cgacgataga
tcggggattt gagatatgag aaggcacgga cactagacaa caagcaaaga aacagatttc gcaaaaaggg tttttaagag
atagttttcc cgctaggcgc cacggcggaa cgggcgctac acaggctttc gcaaacattt tgtaagttaa aaaaaaaaag
aaaacaacac acaaattact caaattatta ataattaaca taagatagaa tgcatgaaCT TGTAAATATA TATGTGCATA
AATGGATTTT ACAACttctt aaatatcaat caaacagttg taaaaagacc taaaaattgt aacattgata aagtaagtat
ccatcgtcgt gcaaaaaaaa aaaagaaact cacaaattca atccacacaa atgagctaga aacaaaataa acaaatttgt
tcatgaatat atctaacact aatcataagc atattttttt gtgtggaatg tgaagattaa atttaatttt atatgtttgt
agagtgacat atatataaca ttgaaaatAA ACTCCTCTGA CATGGGTCGC TGACATATGG TCAGCCACTC AAAATCAGAG
GGTAGCAAGT TAATTAGAGG ATCCATGGTA GTATAAtact ccatccgttt taaaatgttt gacaccgttg actttttagt
acgtgtttga tcattcgtct tattcaaaaa atttaagtaa ttatttattc ttttcatatc atttgattca ttgttaaata
tactttcatg tacacatata gttttacata ttttacaaat ttttttaata agacgaacgg tcaaacatat gctaaaaagt
caacggtgtc aaacattttg aaacggaggg agtaTTTGTT TAAGTTGTAA CTGATGACAA TCTCTTGAAT GTGACGATGG
ATACATATGG ATGGATGATG GAATGGAAGG TGGACAGACG TTACCGGCGA TACCGTGAGC AGATGAGGGC GGTGGAGGTG
TCGTTCGAGG CGGTGGCCGG CGGCGGCGCG GCGCAGGTGT ACACGAAGCT GGCGATGCGA GCCATGTCGC GGCACTTCCG
GTGCCTGAGG GACGCGCTGG TGGGGCAGGT GCGCGCGCTG AGGAACGCCA TGGGGGAGAG CCAGAGGGAC GCCGCCGGCG
GCGTGGCGGC GGCGGCGCCC GGTGCCACCA AGGGCGACAC GCCTCGGCTG CGGGTGCTGG ACCAGTGCCT GAGGCAGCAG
AGGGCGTTCC AGCAGTCCGG CGccgtcgac agcttcccgt ggcgcccgca gcgcggtctg ccggagcgcg ccgtcgccgt
cctccgcgcc tggctcttcg agcacttcct ccacccGTAT GTATATAGTA TTTTTTTTCT CTCCATTTAC AAATTAATCA
TCCCATATTT TGTGATGATT TTTTGTTTTG CACATATTAA TTACAACCGC ACCAAGGTAT CCAAATGATG TGGACAAGCA
CATTTTGGCG CGCCAAACAG GCTTGTCAAG AAGCCAGGTA CTCCTACTTA ATTTCAAATT CATTGAGTAC CCAATTTGTT
ACTGCACTTT TGCAAAGAGA TATATACTCG ATCAATTGGT TTGTGTACGT AGGTTTCGAA TTGGTTCATC AATGCAAGGG
TGAGGCTATG GAAGCCTATG ATAGAAGACA TGTACAAGGA AGAAACGAAG CCGGAATCAT CTGATGGCAA CAACAAATTA
AACCCTAGCG CAGCCGGCAA CAAACAGCAG CATCGAGATG ATCCCAAGAA GAATTACACG GCAACGACAG CAGAAGCCAG
CTTAGTACAA CAAAGCAGCT ACCATCTCCA CCTTCGCAGC AGCGGAAACC GTAACTCCTC CTCGTTGATG ATCCCTGCAG
CAGCATCAAC ATCCATCGAT CATCACCATG ACAGCAGCCA CCAGCTGTTG GGCGGCCATA GCTATTCTTC AGCAGCAGGA
TTGCATCATG GTCATGGCGG CGCCGTGTCG CTTACTCTAG GGCTCCAGCA GCAGCAGCAG CCATTTGCGG CGTCGATGAT
GCATCAGCAT CAGCAGCACC AGCACCAGCA CCAGCAGCAG CAGTCATTCA TGGTGGAGGC GGCGGAGGAA GAAGAAGATG
ACGTGCTCCC TTACAGGAAC CTCATGGAGT CTCAGTTGCT GCATGATTTT GCAGGAGCTA GCTAAGGCAG GCTCCAGCTT
AGCATGCAGC TAATTTATTT GATTGTTAAA GGAGATTATT GCGCTCAAAA GTTTAATTTA ATTAAGGAGA TGTAGGTAAT
TAAATATTAC ATTATTGTTC TTTTATGACC AAACATTTCG TTACATTATT TGGGGATTTC TTTTGTAAAA ATCAGCCCAC
CACTTCTGTT CTGGCCTAGC TAGCTTAGCA TGCAGTGATG TGGAACCCAC CCTTGCAATC CCATCTGGGC CCATGACAAG
TTAGTTACTT Agagcacccg caatggtaaa gtaaggtgtt atctataaaa catgtacatc tcagcaatag actagattaa
tagtaaacca cttcaatggt atgtctacat gggtatct

Locus: Os06g0108900

Loading...

Locus: Os06g0108900

Loading...