Os06t0111800-01

Locus

Os06g0111800

Description

Similar to CSLD2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLD2, CSLD2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE D2, CELLULOSE SYNTHASE LIKE D2

Oryzabase Gene Symbol Synonym(s)

OsCSLD2, OsCslD2, OsCSLD2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK102134 (DDBJ, Best hit)

Protein Evidence

B7EXX7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Full-length cDNA

J033085F12 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0111800-01)

RiceXPro (AK102134)

Others

Oryzabase (13897)

Oryzabase (9013)

KEGG (Os06t0111800-01)

Transcript

3967 bp

>Os06t0111800-01 Similar to CSLD2 (Fragment).
GCTGCAGCAGCCGCTTGCTTCCTGTGAGACTTCGTCGTCGTCTTCTCCGAGCTTAGCTTT
CACCAAACCACTAGTACTTGTACTCACTCTTCGCTTCCCAAATCTTCCTCATCAATTGCT
AACACGAGTAGTCTATCATCATTAACTCGCATCCCTTCCCCTTCCATTGCTCATTGTCTT
TCCATTCATACGGTGTTGTGTTGTTGTGGCCCAAGAAGAAGAACAAGTACACCACACGCC
ATTACTCCCATCTCTCTTACTCCTCCTCGAGTTTGATTGATTCGAGTGGTCGCATCGCAT
GATCAGAAAGTGAGGCGATCGATccatggcttccagcggcggcggcggcctgcgtcacag
caacagcagccgcctctcgcgcatgtcctactccggcgaggacggccgcgctcaggcccc
cggcggcggcggcgaccggccgatggtgacgttcgcccgccgcacccactcggggcgcta
cgtgagctactcccgcgacgacctcgacagcgagctcggcaacagcggcgacatgtcgcc
ggagtctgggcaggagttcctcaactaccacgtgacgatcccggcgacgccggacaacca
gccgatggacccggccatctcggcgcgcgtggaggagcagtacgtctccaactcgctctt
caccggcggcttcaacagcgtcacgcgggcgcacctcatggacaaggtgatcgagtcgga
ggccagccacccgcagatggccggcgccaagggctcctcctgcgccatcaacggctgcga
cgccaaggtcatgagcgacgagcgcggcgacgacatcctcccctgcgagtgcgacttcaa
gatctgcgccgactgcttcgccgacgccgtcaagaacggcggcgcctgccccggctgcaa
ggacccctacaaggccaccgagctcgacgacgtggtcggtgcgaggccgacgctgtcgct
gcctccgccgcccggtggcttgccggcgtcgaggatggagaggcggctgtcgataatgcg
gtcgcagaaggccatgaccaggagccagaccggcgattgggatcacaatcggtggctgtt
cgagaccaaggggacatacgggtatggcaatgccatttggcccaaggagaacgaggtcga
caatggcggtggcggtggcggaggcggcgggctgggtggaggcgacggccagccggcaga
gttcacgagcaagccatggaggccgctcactcgcaagctcaagattcctgcgggtgtcct
tagcccatacaggcttcttattcttattcgtatggctgttcttggtctattccttgcatg
gagaattaagcacaagaatgaggatgcaatgtggctatggggcatgtctgttgtttgcga
actctggtttggcctctcttggctcttggatcagctgccaaagttgtgccctgttaaccg
agcaactgaccttgctgtcctgaaagataagtttgagaccccgacgccatcaaatcctaa
cggaagatctgacctgccggggctcgatatatttgtgtctactgctgatccagaaaaaga
acccccattggtcacagcaaatactattctgtccatccttgctgctgattatcctgttga
gaagctttcttgctatgtttctgatgatggaggcgctctcctgacatttgaagcaatggc
tgaagccgctagctttgcaaacatgtgggttcctttctgtcgcaaacatgacattgagcc
tcgcaacccagagagctactttaatctgaagagggacccatacaagaacaaggtccgttc
tgattttgtcaaggacagaagaagggtgaagagggagtacgacgagttcaaggtcaggat
caatagcttgcctgattcaatccgtcgccgctccgatgcatatcatgccagggaggaaat
caaggccatgaagcggcaacgagaggctgctctcgatgacgtggtggaggctgttaaaat
ccctaaagctacctggatggctgatggcacgcattggcctggtacctggattcagccctc
tgctgagcatgctcggggtgaccatgctggaataattcaggtaatgctgaaacctcctag
tgatgatcccttgtatggaaccagcggtgaagaaggcagacctcttgatttcactgaggt
tgacatccgtttgccaatgttggtctatgtgtcccgagagaagcgtcctggttatgatca
caacaagaaggctggtgcgatgaatgcgttggtccgctcatctgctgtcatgtcaaatgg
acctttcatcctcaaccttgattgtgatcactatgtttacaactcacaagctttccgtga
aggcatgtgcttcatgatggatcgtggtggtgaccgtattggctatgtccagttccctca
acggtttgagggcattgatccatcagatcgatatgctaaccacaacactgtcttcttcga
tgtcaacatgcgtgcacttgatggtatcatgggaccagtctacgtcggcactggatgtct
tttccgtcgcatcgctttgtatggatttgacccaccgcgctccaaggaacatagtggttg
ctgcagctgttgcttcccccagaggcgcaaggttaaaacttccacagttgcatctgaaga
gaggcaggctttgagaatggcagattttgatgatgaggaaatgaacatgtcacaatttcc
caagaagttcggtaattcaaacttcctcatcaactctatcccaattgctgaattccaagg
gcgacctcttgctgaccatcctggagtcaaaaatggacgtcctcctggtgctctcaccgt
ccctcgcgaccttctcgatgcttccacagttgctgaggctatcagtgtcatctcatgctg
gtatgaagataagactgagtggggtcagcgtgttggatggatctatggttcagtcacaga
ggatgtggtcactggttacaggatgcacaaccgtggatggaaatcagtttactgtgtcac
caaacgtgatgctttccgtggcactgcaccaatcaaccttactgaccgtcttcatcaggt
gctccggtgggctactggttcagtggaaatcttcttctcccgcaacaatgcactacttgc
aagccgaaagatgaagtttcttcagaggattgcatacctgaacgttggcatttacccctt
cacatcaatcttcctcattgtctactgcttcctgccagccctgtccctcttctcgggaca
gttcattgtgcggacgctaaatgtgaccttcctgacctatctgctcgttatcactctgac
aatgtgcatgcttgcggtgctcgagatcaagtggtcaggcatcagcttggaggaatggtg
gaggaatgagcagttctggctaatcggaggaactagcgcccaccttgctgctgttcttca
gggtcttctcaaggtgattgctggtatcgagatctccttcacgctgacatccaaatctgg
aggagatgaagcagacgacgagtttgctgatctctacatcgtcaagtggacatcactcat
gatcccaccgatcgtcatcatgatggttaacctgatcgccatcgctgtcgggttcagcag
gacaatatacagtgaaatccctcagtggagcaagctcctcggcggcgtgttcttcagctt
ctgggtgctggctcacctttaccccttcgccaaggggctaatgggaaggagaggacgaac
accgaccatcgtcttcgtctggtctggcctccttgccatcaccatctcattgctgtgggt
tgccatcaatccgccgtcacagaactcgcagataggcggctccttcacattcccctgagc
ttcctcatgaacatgaaccttttgtatgatgaattataagagtggtcccagtagcagttg
tccttgctgttggacaagtaaattctttacctatgtttacttaggtttttcttttttttt
tgggtcg

CDS

3513 bp

>Os06t0111800-01 Similar to CSLD2 (Fragment).
atggcttccagcggcggcggcggcctgcgtcacagcaacagcagccgcctctcgcgcatg
tcctactccggcgaggacggccgcgctcaggcccccggcggcggcggcgaccggccgatg
gtgacgttcgcccgccgcacccactcggggcgctacgtgagctactcccgcgacgacctc
gacagcgagctcggcaacagcggcgacatgtcgccggagtctgggcaggagttcctcaac
taccacgtgacgatcccggcgacgccggacaaccagccgatggacccggccatctcggcg
cgcgtggaggagcagtacgtctccaactcgctcttcaccggcggcttcaacagcgtcacg
cgggcgcacctcatggacaaggtgatcgagtcggaggccagccacccgcagatggccggc
gccaagggctcctcctgcgccatcaacggctgcgacgccaaggtcatgagcgacgagcgc
ggcgacgacatcctcccctgcgagtgcgacttcaagatctgcgccgactgcttcgccgac
gccgtcaagaacggcggcgcctgccccggctgcaaggacccctacaaggccaccgagctc
gacgacgtggtcggtgcgaggccgacgctgtcgctgcctccgccgcccggtggcttgccg
gcgtcgaggatggagaggcggctgtcgataatgcggtcgcagaaggccatgaccaggagc
cagaccggcgattgggatcacaatcggtggctgttcgagaccaaggggacatacgggtat
ggcaatgccatttggcccaaggagaacgaggtcgacaatggcggtggcggtggcggaggc
ggcgggctgggtggaggcgacggccagccggcagagttcacgagcaagccatggaggccg
ctcactcgcaagctcaagattcctgcgggtgtccttagcccatacaggcttcttattctt
attcgtatggctgttcttggtctattccttgcatggagaattaagcacaagaatgaggat
gcaatgtggctatggggcatgtctgttgtttgcgaactctggtttggcctctcttggctc
ttggatcagctgccaaagttgtgccctgttaaccgagcaactgaccttgctgtcctgaaa
gataagtttgagaccccgacgccatcaaatcctaacggaagatctgacctgccggggctc
gatatatttgtgtctactgctgatccagaaaaagaacccccattggtcacagcaaatact
attctgtccatccttgctgctgattatcctgttgagaagctttcttgctatgtttctgat
gatggaggcgctctcctgacatttgaagcaatggctgaagccgctagctttgcaaacatg
tgggttcctttctgtcgcaaacatgacattgagcctcgcaacccagagagctactttaat
ctgaagagggacccatacaagaacaaggtccgttctgattttgtcaaggacagaagaagg
gtgaagagggagtacgacgagttcaaggtcaggatcaatagcttgcctgattcaatccgt
cgccgctccgatgcatatcatgccagggaggaaatcaaggccatgaagcggcaacgagag
gctgctctcgatgacgtggtggaggctgttaaaatccctaaagctacctggatggctgat
ggcacgcattggcctggtacctggattcagccctctgctgagcatgctcggggtgaccat
gctggaataattcaggtaatgctgaaacctcctagtgatgatcccttgtatggaaccagc
ggtgaagaaggcagacctcttgatttcactgaggttgacatccgtttgccaatgttggtc
tatgtgtcccgagagaagcgtcctggttatgatcacaacaagaaggctggtgcgatgaat
gcgttggtccgctcatctgctgtcatgtcaaatggacctttcatcctcaaccttgattgt
gatcactatgtttacaactcacaagctttccgtgaaggcatgtgcttcatgatggatcgt
ggtggtgaccgtattggctatgtccagttccctcaacggtttgagggcattgatccatca
gatcgatatgctaaccacaacactgtcttcttcgatgtcaacatgcgtgcacttgatggt
atcatgggaccagtctacgtcggcactggatgtcttttccgtcgcatcgctttgtatgga
tttgacccaccgcgctccaaggaacatagtggttgctgcagctgttgcttcccccagagg
cgcaaggttaaaacttccacagttgcatctgaagagaggcaggctttgagaatggcagat
tttgatgatgaggaaatgaacatgtcacaatttcccaagaagttcggtaattcaaacttc
ctcatcaactctatcccaattgctgaattccaagggcgacctcttgctgaccatcctgga
gtcaaaaatggacgtcctcctggtgctctcaccgtccctcgcgaccttctcgatgcttcc
acagttgctgaggctatcagtgtcatctcatgctggtatgaagataagactgagtggggt
cagcgtgttggatggatctatggttcagtcacagaggatgtggtcactggttacaggatg
cacaaccgtggatggaaatcagtttactgtgtcaccaaacgtgatgctttccgtggcact
gcaccaatcaaccttactgaccgtcttcatcaggtgctccggtgggctactggttcagtg
gaaatcttcttctcccgcaacaatgcactacttgcaagccgaaagatgaagtttcttcag
aggattgcatacctgaacgttggcatttaccccttcacatcaatcttcctcattgtctac
tgcttcctgccagccctgtccctcttctcgggacagttcattgtgcggacgctaaatgtg
accttcctgacctatctgctcgttatcactctgacaatgtgcatgcttgcggtgctcgag
atcaagtggtcaggcatcagcttggaggaatggtggaggaatgagcagttctggctaatc
ggaggaactagcgcccaccttgctgctgttcttcagggtcttctcaaggtgattgctggt
atcgagatctccttcacgctgacatccaaatctggaggagatgaagcagacgacgagttt
gctgatctctacatcgtcaagtggacatcactcatgatcccaccgatcgtcatcatgatg
gttaacctgatcgccatcgctgtcgggttcagcaggacaatatacagtgaaatccctcag
tggagcaagctcctcggcggcgtgttcttcagcttctgggtgctggctcacctttacccc
ttcgccaaggggctaatgggaaggagaggacgaacaccgaccatcgtcttcgtctggtct
ggcctccttgccatcaccatctcattgctgtgggttgccatcaatccgccgtcacagaac
tcgcagataggcggctccttcacattcccctga

Protein

1171 aa

>Os06t0111800-01 Similar to CSLD2 (Fragment).
MASSGGGGLRHSNSSRLSRMSYSGEDGRAQAPGGGGDRPMVTFARRTHSGRYVSYSRDDL
DSELGNSGDMSPESGQEFLNYHVTIPATPDNQPMDPAISARVEEQYVSNSLFTGGFNSVT
RAHLMDKVIESEASHPQMAGAKGSSCAINGCDAKVMSDERGDDILPCECDFKICADCFAD
AVKNGGACPGCKDPYKATELDDVVGARPTLSLPPPPGGLPASRMERRLSIMRSQKAMTRS
QTGDWDHNRWLFETKGTYGYGNAIWPKENEVDNGGGGGGGGGLGGGDGQPAEFTSKPWRP
LTRKLKIPAGVLSPYRLLILIRMAVLGLFLAWRIKHKNEDAMWLWGMSVVCELWFGLSWL
LDQLPKLCPVNRATDLAVLKDKFETPTPSNPNGRSDLPGLDIFVSTADPEKEPPLVTANT
ILSILAADYPVEKLSCYVSDDGGALLTFEAMAEAASFANMWVPFCRKHDIEPRNPESYFN
LKRDPYKNKVRSDFVKDRRRVKREYDEFKVRINSLPDSIRRRSDAYHAREEIKAMKRQRE
AALDDVVEAVKIPKATWMADGTHWPGTWIQPSAEHARGDHAGIIQVMLKPPSDDPLYGTS
GEEGRPLDFTEVDIRLPMLVYVSREKRPGYDHNKKAGAMNALVRSSAVMSNGPFILNLDC
DHYVYNSQAFREGMCFMMDRGGDRIGYVQFPQRFEGIDPSDRYANHNTVFFDVNMRALDG
IMGPVYVGTGCLFRRIALYGFDPPRSKEHSGCCSCCFPQRRKVKTSTVASEERQALRMAD
FDDEEMNMSQFPKKFGNSNFLINSIPIAEFQGRPLADHPGVKNGRPPGALTVPRDLLDAS
TVAEAISVISCWYEDKTEWGQRVGWIYGSVTEDVVTGYRMHNRGWKSVYCVTKRDAFRGT
APINLTDRLHQVLRWATGSVEIFFSRNNALLASRKMKFLQRIAYLNVGIYPFTSIFLIVY
CFLPALSLFSGQFIVRTLNVTFLTYLLVITLTMCMLAVLEIKWSGISLEEWWRNEQFWLI
GGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDEADDEFADLYIVKWTSLMIPPIVIMM
VNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIVFVWS
GLLAITISLLWVAINPPSQNSQIGGSFTFP*

5'UTR

chr06:665091..665391 (- strand) : 301 bp

chr06:664646..664669 (- strand) : 24 bp

CDS

chr06:663699..664645 (- strand) : 947 bp

chr06:662576..663383 (- strand) : 808 bp

chr06:660509..662266 (- strand) : 1758 bp

3'UTR

chr06:660380..660508 (- strand) : 129 bp

FASTA

>Os06t0111800-01 class=Sequence position=chr06:660380..665391 (- strand)
GCTGCAGCAG CCGCTTGCTT CCTGTGAGAC TTCGTCGTCG TCTTCTCCGA GCTTAGCTTT CACCAAACCA CTAGTACTTG
TACTCACTCT TCGCTTCCCA AATCTTCCTC ATCAATTGCT AACACGAGTA GTCTATCATC ATTAACTCGC ATCCCTTCCC
CTTCCATTGC TCATTGTCTT TCCATTCATA CGGTGTTGTG TTGTTGTGGC CCAAGAAGAA GAACAAGTAC ACCACACGCC
ATTACTCCCA TCTCTCTTAC TCCTCCTCGA GTTTGATTGA TTCGAGTGGT CGCATCGCAT GGTAAGAAAA CCATTTCCAT
CCATCTGATC TGATGAATCT GTGGGCTGTT CTCTGGTTTT TGAATCGGTC AGTCTGCGTT TGCCGGCGGT GTTGGATTTA
GGGTTGAGTG AACACTGAAT TTATCTCTTC GGATTCCATT CGATTTTTTT TATGCTTCTT GCTTCGTGTT CTGTGGGCGA
CGGCGACAAG GTTTTGCTGC TCAGATTTGT TCTTCCCTTT TGCTTTCCAA AGTTTGAATC TTGGGTTTGG GTCCCGGGAT
TTCAGCCTAT TCTCTCGCTG CCTGTCTGAT TCTGATTTCT TTCCAAAGAC GGGAATCTTC GAGCACAAAT CTGCCATTTT
TATCCTCGTA CGCGATAAAG ACTAGCTCTT TAATTTTCCG ATCCCCACCT CGCGATGCTG ATTTGGTTCC TTCGATTCGC
AGATCAGAAA GTGAGGCGAT CGATccatgg cttccagcgg cggcggcggc ctgcgtcaca gcaacagcag ccgcctctcg
cgcatgtcct actccggcga ggacggccgc gctcaggccc ccggcggcgg cggcgaccgg ccgatggtga cgttcgcccg
ccgcacccac tcggggcgct acgtgagcta ctcccgcgac gacctcgaca gcgagctcgg caacagcggc gacatgtcgc
cggagtctgg gcaggagttc ctcaactacc acgtgacgat cccggcgacg ccggacaacc agccgatgga cccggccatc
tcggcgcgcg tggaggagca gtacgtctcc aactcgctct tcaccggcgg cttcaacagc gtcacgcggg cgcacctcat
ggacaaggtg atcgagtcgg aggccagcca cccgcagatg gccggcgcca agggctcctc ctgcgccatc aacggctgcg
acgccaaggt catgagcgac gagcgcggcg acgacatcct cccctgcgag tgcgacttca agatctgcgc cgactgcttc
gccgacgccg tcaagaacgg cggcgcctgc cccggctgca aggaccccta caaggccacc gagctcgacg acgtggtcgg
tgcgaggccg acgctgtcgc tgcctccgcc gcccggtggc ttgccggcgt cgaggatgga gaggcggctg tcgataatgc
ggtcgcagaa ggccatgacc aggagccaga ccggcgattg ggatcacaat cggtggctgt tcgagaccaa ggggacatac
gggtatggca atgccatttg gcccaaggag aacgaggtcg acaatggcgg tggcggtggc ggaggcggcg ggctgggtgg
aggcgacggc cagccggcag agttcacgag caagccatgg aggccgctca ctcgcaagct caagattcct gcgggtgtcc
ttagcccata caggtgaatg gctcacatgt ccatccatgt gctcacattt gactgattgg atccgttgat ctggtagaaa
gtactatatt gttttgagat gcatttgatt tgtttagtgt tggaaatgaa actaaaaaac aaacctggat ttgtagatat
atactcccag ctgttagatc tctgctcaat agataaatat gttagctgac ttgttagatc tgttctattt cctctgatct
ctccagcttc caaacaaata cacaatatta tagctaatct tataattcag tttatagatg ctaaccttag tttggttgtt
ccatgcaggc ttcttattct tattcgtatg gctgttcttg gtctattcct tgcatggaga attaagcaca agaatgagga
tgcaatgtgg ctatggggca tgtctgttgt ttgcgaactc tggtttggcc tctcttggct cttggatcag ctgccaaagt
tgtgccctgt taaccgagca actgaccttg ctgtcctgaa agataagttt gagaccccga cgccatcaaa tcctaacgga
agatctgacc tgccggggct cgatatattt gtgtctactg ctgatccaga aaaagaaccc ccattggtca cagcaaatac
tattctgtcc atccttgctg ctgattatcc tgttgagaag ctttcttgct atgtttctga tgatggaggc gctctcctga
catttgaagc aatggctgaa gccgctagct ttgcaaacat gtgggttcct ttctgtcgca aacatgacat tgagcctcgc
aacccagaga gctactttaa tctgaagagg gacccataca agaacaaggt ccgttctgat tttgtcaagg acagaagaag
ggtgaagagg gagtacgacg agttcaaggt caggatcaat agcttgcctg attcaatccg tcgccgctcc gatgcatatc
atgccaggga ggaaatcaag gccatgaagc ggcaacgaga ggctgctctc gatgacgtgg tggaggctgt taaaatccct
aaagctacct ggatggctga tggcacgcat tggcctggta cctggattca gccctctgct gagcatgctc ggggtgacca
tgctggaata attcaggtag acattcttac atcacctttc tccttgcttt tcatatatgg cttttcacat tcttacatca
cctttctcct tgcttttcat atatggcttg caatcgaaat atattagcta gctgcatata aacagtattg cacgtttgca
caaatgatta ctgttcattt ttgttttttc ccttgagcag aagcatgtgc atccttttta ccgttttaat atctagcagt
atctctatgg ggcttgcctc tatctatctt gtagtagtga accaggaaaa tgccacctgt ttgatcattg ccgtattgtg
ttcaggtaat gctgaaacct cctagtgatg atcccttgta tggaaccagc ggtgaagaag gcagacctct tgatttcact
gaggttgaca tccgtttgcc aatgttggtc tatgtgtccc gagagaagcg tcctggttat gatcacaaca agaaggctgg
tgcgatgaat gcgttggtcc gctcatctgc tgtcatgtca aatggacctt tcatcctcaa ccttgattgt gatcactatg
tttacaactc acaagctttc cgtgaaggca tgtgcttcat gatggatcgt ggtggtgacc gtattggcta tgtccagttc
cctcaacggt ttgagggcat tgatccatca gatcgatatg ctaaccacaa cactgtcttc ttcgatgtca acatgcgtgc
acttgatggt atcatgggac cagtctacgt cggcactgga tgtcttttcc gtcgcatcgc tttgtatgga tttgacccac
cgcgctccaa ggaacatagt ggttgctgca gctgttgctt cccccagagg cgcaaggtta aaacttccac agttgcatct
gaagagaggc aggctttgag aatggcagat tttgatgatg aggaaatgaa catgtcacaa tttcccaaga agttcggtaa
ttcaaacttc ctcatcaact ctatcccaat tgctgaattc caagggcgac ctcttgctga ccatcctgga gtcaaaaatg
gacgtcctcc tggtgctctc accgtccctc gcgaccttct cgatgcttcc acagttgctg aggctatcag tgtcatctca
tgctggtatg aagataagac tgagtggggt cagcgtgttg gatggatcta tggttcagtc acagaggatg tggtcactgg
ttacaggatg cacaaccgtg gatggaaatc agtttactgt gtcaccaaac gtgatgcttt ccgtggcact gcaccaatca
accttactga ccgtcttcat caggtgctcc ggtgggctac tggttcagtg gaaatcttct tctcccgcaa caatgcacta
cttgcaagcc gaaagatgaa gtttcttcag aggattgcat acctgaacgt tggcatttac cccttcacat caatcttcct
cattgtctac tgcttcctgc cagccctgtc cctcttctcg ggacagttca ttgtgcggac gctaaatgtg accttcctga
cctatctgct cgttatcact ctgacaatgt gcatgcttgc ggtgctcgag atcaagtggt caggcatcag cttggaggaa
tggtggagga atgagcagtt ctggctaatc ggaggaacta gcgcccacct tgctgctgtt cttcagggtc ttctcaaggt
gattgctggt atcgagatct ccttcacgct gacatccaaa tctggaggag atgaagcaga cgacgagttt gctgatctct
acatcgtcaa gtggacatca ctcatgatcc caccgatcgt catcatgatg gttaacctga tcgccatcgc tgtcgggttc
agcaggacaa tatacagtga aatccctcag tggagcaagc tcctcggcgg cgtgttcttc agcttctggg tgctggctca
cctttacccc ttcgccaagg ggctaatggg aaggagagga cgaacaccga ccatcgtctt cgtctggtct ggcctccttg
ccatcaccat ctcattgctg tgggttgcca tcaatccgcc gtcacagaac tcgcagatag gcggctcctt cacattcccc
tgagcttcct catgaacatg aaccttttgt atgatgaatt ataagagtgg tcccagtagc agttgtcctt gctgttggac
aagtaaattc tttacctatg tttacttagg tttttctttt ttttttgggt cg

Locus: Os06g0111800

Loading...

Locus: Os06g0111800

Loading...