Os06t0111800-02

Locus

Os06g0111800

Description

Similar to CSLD2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLD2, CSLD2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE D2, CELLULOSE SYNTHASE LIKE D2

Oryzabase Gene Symbol Synonym(s)

OsCSLD2, OsCslD2, OsCSLD2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK105393 (DDBJ, Best hit)

Protein Evidence

Q9LHZ7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Full-length cDNA

001-123-B04 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0111800-02)

RiceXPro (AK105393)

Others

Oryzabase (13897)

Oryzabase (9013)

KEGG (Os06t0111800-02)

Transcript

4089 bp

>Os06t0111800-02 Similar to CSLD2 (Fragment).
ATCAATTGCTAACACGAGTAGTCTATCATCATTAACTCGCATCCCTTCCCCTTCCATTGC
TCATTGTCTTTCCATTCATACGGTGTTGTGTTGTTGTGGCCCAAGAAGAAGAACAAGTAC
ACCACACGCCATTACTCCCATCTCTCTTACTCCTCCTCGAGTTTGATTGATTCGAGTGGT
CGCATCGCATGATCAGAAAGTGAGGCGATCGATccatggcttccagcggcggcggcggcc
tgcgtcacagcaacagcagccgcctctcgcgcatgtcctactccggcgaggacggccgcg
ctcaggcccccggcggcggcggcgaccggccgatggtgacgttcgcccgccgcacccact
cggggcgctacgtgagctactcccgcgacgacctcgacagcgagctcggcaacagcggcg
acatgtcgccggagtctgggcaggagttcctcaactaccacgtgacgatcccggcgacgc
cggacaaccagccgatggacccggccatctcggcgcgcgtggaggagcagtacgtctcca
actcgctcttcaccggcggcttcaacagcgtcacgcgggcgcacctcatggacaaggtga
tcgagtcggaggccagccacccgcagatggccggcgccaagggctcctcctgcgccatca
acggctgcgacgccaaggtcatgagcgacgagcgcggcgacgacatcctcccctgcgagt
gcgacttcaagatctgcgccgactgcttcgccgacgccgtcaagaacggcggcgcctgcc
ccggctgcaaggacccctacaaggccaccgagctcgacgacgtggtcggtgcgaggccga
cgctgtcgctgcctccgccgcccggtggcttgccggcgtcgaggatggagaggcggctgt
cgataatgcggtcgcagaaggccatgaccaggagccagaccggcgattgggatcacaatc
ggtggctgttcgagaccaaggggacatacgggtatggcaatgccatttggcccaaggaga
acgaggtcgacaatggcggtggcggtggcggaggcggcgggctgggtggaggcgacggcc
agccggcagagttcacgagcaagccatggaggccgctcactcgcaagctcaagattcctg
cgggtgtccttagcccatacaggcttcttattcttattcgtatggctgttcttggtctat
tccttgcatggagaattaagcacaagaatgaggatgcaatgtggctatggggcatgtctg
ttgtttgcgaactctggtttggcctctcttggctcttggatcagctgccaaagttgtgcc
ctgttaaccgagcaactgaccttgctgtcctgaaagataagtttgagaccccgacgccat
caaatcctaacggaagatctgacctgccggggctcgatatatttgtgtctactgctgatc
cagaaaaagaacccccattggtcacagcaaatactattctgtccatccttgctgctgatt
atcctgttgagaagctttcttgctatgtttctgatgatggaggcgctctcctgacatttg
aagcaatggctgaagccgctagctttgcaaacatgtgggttcctttctgtcgcaaacatg
acattgagcctcgcaacccagagagctactttaatctgaagagggacccatacaagaaca
aggtccgttctgattttgtcaaggacagaagaagggtgaagagggagtacgacgagttca
aggtcaggatcaatagcttgcctgattcaatccgtcgccgctccgatgcatatcatgcca
gggaggaaatcaaggccatgaagcggcaacgagaggctgctctcgatgacgtggtggagg
ctgttaaaatccctaaagctacctggatggctgatggcacgcattggcctggtacctgga
ttcagccctctgctgagcatgctcggggtgaccatgctggaataattcaggtaatgctga
aacctcctagtgatgatcccttgtatggaaccagcggtgaagaaggcagacctcttgatt
tcactgaggttgacatccgtttgccaatgttggtctatgtgtcccgagagaagcgtcctg
gttatgatcacaacaagaaggctggtgcgatgaatgcgttggtccgctcatctgctgtca
tgtcaaatggacctttcatcctcaaccttgattgtgatcactatgtttacaactcacaag
ctttccgtgaaggcatgtgcttcatgatggatcgtggtggtgaccgtattggctatgtcc
agttccctcaacggtttgagggcattgatccatcagatcgatatgctaaccacaacactg
tcttcttcgatgtcaacatgcgtgcacttgatggtatcatgggaccagtctacgtcggca
ctggatgtcttttccgtcgcatcgctttgtatggatttgacccaccgcgctccaaggaac
atagtggttgctgcagctgttgcttcccccagaggcgcaaggttaaaacttccacagttg
catctgaagagaggcaggctttgagaatggcagattttgatgatgaggaaatgaacatgt
cacaatttcccaagaagttcggtaattcaaacttcctcatcaactctatcccaattgctg
aattccaagggcgacctcttgctgaccatcctggagtcaaaaatggacgtcctcctggtg
ctctcaccgtccctcgcgaccttctcgatgcttccacagttgctgaggctatcagtgtca
tctcatgctggtatgaagataagactgagtggggtcagcgtgttggatggatctatggtt
cagtcacagaggatgtggtcactggttacaggatgcacaaccgtggatggaaatcagttt
actgtgtcaccaaacgtgatgctttccgtggcactgcaccaatcaaccttactgaccgtc
ttcatcaggtgctccggtgggctactggttcagtggaaatcttcttctcccgcaacaatg
cactacttgcaagccgaaagatgaagtttcttcagaggattgcatacctgaacgttggca
tttaccccttcacatcaatcttcctcattgtctactgcttcctgccagccctgtccctct
tctcgggacagttcattgtgcggacgctaaatgtgaccttcctgacctatctgctcgtta
tcactctgacaatgtgcatgcttgcggtgctcgagatcaagtggtcaggcatcagcttgg
aggaatggtggaggaatgagcagttctggctaatcggaggaactagcgcccaccttgctg
ctgttcttcagggtcttctcaaggtgattgctggtatcgagatctccttcacgctgacat
ccaaatctggaggagatgaagcagacgacgagtttgctgatctctacatcgtcaagtgga
catcactcatgatcccaccgatcgtcatcatgatggttaacctgatcgccatcgctgtcg
ggttcagcaggacaatatacagtgaaatccctcagtggagcaagctcctcggcggcgtgt
tcttcagcttctgggtgctggctcacctttaccccttcgccaaggggctaatgggaagga
gaggacgaacaccgaccatcgtcttcgtctggtctggcctccttgccatcaccatctcat
tgctgtgggttgccatcaatccgccgtcacagaactcgcagataggcggctccttcacat
tcccctgagcttcctcatgaacatgaaccttttgtatgatgaattataagagtggtccca
gtagcagttgtccttgctgttggacaagtaaattctttacctatgtttacttaggttttt
cttttttttttgggtcgaagatgatactattatgaatcatgcatgatactagttcttttg
ttcgtttTTGTGCCAAAATGAGAAGAGGTTCTGTTTGGACCTGAACATCAATCAATTGCA
AAAATTCGGAGACTAGGAAGTTCAGAGTTGCACTCCTGCACTTCTTTGGAGCTCTTCCAT
TCTGCATAACTGCGCTGTCTACTTGTATTGCATTTGCCTACTCTTAATCCTTCACTTTGC
AGTAGTACT

CDS

3513 bp

>Os06t0111800-02 Similar to CSLD2 (Fragment).
atggcttccagcggcggcggcggcctgcgtcacagcaacagcagccgcctctcgcgcatg
tcctactccggcgaggacggccgcgctcaggcccccggcggcggcggcgaccggccgatg
gtgacgttcgcccgccgcacccactcggggcgctacgtgagctactcccgcgacgacctc
gacagcgagctcggcaacagcggcgacatgtcgccggagtctgggcaggagttcctcaac
taccacgtgacgatcccggcgacgccggacaaccagccgatggacccggccatctcggcg
cgcgtggaggagcagtacgtctccaactcgctcttcaccggcggcttcaacagcgtcacg
cgggcgcacctcatggacaaggtgatcgagtcggaggccagccacccgcagatggccggc
gccaagggctcctcctgcgccatcaacggctgcgacgccaaggtcatgagcgacgagcgc
ggcgacgacatcctcccctgcgagtgcgacttcaagatctgcgccgactgcttcgccgac
gccgtcaagaacggcggcgcctgccccggctgcaaggacccctacaaggccaccgagctc
gacgacgtggtcggtgcgaggccgacgctgtcgctgcctccgccgcccggtggcttgccg
gcgtcgaggatggagaggcggctgtcgataatgcggtcgcagaaggccatgaccaggagc
cagaccggcgattgggatcacaatcggtggctgttcgagaccaaggggacatacgggtat
ggcaatgccatttggcccaaggagaacgaggtcgacaatggcggtggcggtggcggaggc
ggcgggctgggtggaggcgacggccagccggcagagttcacgagcaagccatggaggccg
ctcactcgcaagctcaagattcctgcgggtgtccttagcccatacaggcttcttattctt
attcgtatggctgttcttggtctattccttgcatggagaattaagcacaagaatgaggat
gcaatgtggctatggggcatgtctgttgtttgcgaactctggtttggcctctcttggctc
ttggatcagctgccaaagttgtgccctgttaaccgagcaactgaccttgctgtcctgaaa
gataagtttgagaccccgacgccatcaaatcctaacggaagatctgacctgccggggctc
gatatatttgtgtctactgctgatccagaaaaagaacccccattggtcacagcaaatact
attctgtccatccttgctgctgattatcctgttgagaagctttcttgctatgtttctgat
gatggaggcgctctcctgacatttgaagcaatggctgaagccgctagctttgcaaacatg
tgggttcctttctgtcgcaaacatgacattgagcctcgcaacccagagagctactttaat
ctgaagagggacccatacaagaacaaggtccgttctgattttgtcaaggacagaagaagg
gtgaagagggagtacgacgagttcaaggtcaggatcaatagcttgcctgattcaatccgt
cgccgctccgatgcatatcatgccagggaggaaatcaaggccatgaagcggcaacgagag
gctgctctcgatgacgtggtggaggctgttaaaatccctaaagctacctggatggctgat
ggcacgcattggcctggtacctggattcagccctctgctgagcatgctcggggtgaccat
gctggaataattcaggtaatgctgaaacctcctagtgatgatcccttgtatggaaccagc
ggtgaagaaggcagacctcttgatttcactgaggttgacatccgtttgccaatgttggtc
tatgtgtcccgagagaagcgtcctggttatgatcacaacaagaaggctggtgcgatgaat
gcgttggtccgctcatctgctgtcatgtcaaatggacctttcatcctcaaccttgattgt
gatcactatgtttacaactcacaagctttccgtgaaggcatgtgcttcatgatggatcgt
ggtggtgaccgtattggctatgtccagttccctcaacggtttgagggcattgatccatca
gatcgatatgctaaccacaacactgtcttcttcgatgtcaacatgcgtgcacttgatggt
atcatgggaccagtctacgtcggcactggatgtcttttccgtcgcatcgctttgtatgga
tttgacccaccgcgctccaaggaacatagtggttgctgcagctgttgcttcccccagagg
cgcaaggttaaaacttccacagttgcatctgaagagaggcaggctttgagaatggcagat
tttgatgatgaggaaatgaacatgtcacaatttcccaagaagttcggtaattcaaacttc
ctcatcaactctatcccaattgctgaattccaagggcgacctcttgctgaccatcctgga
gtcaaaaatggacgtcctcctggtgctctcaccgtccctcgcgaccttctcgatgcttcc
acagttgctgaggctatcagtgtcatctcatgctggtatgaagataagactgagtggggt
cagcgtgttggatggatctatggttcagtcacagaggatgtggtcactggttacaggatg
cacaaccgtggatggaaatcagtttactgtgtcaccaaacgtgatgctttccgtggcact
gcaccaatcaaccttactgaccgtcttcatcaggtgctccggtgggctactggttcagtg
gaaatcttcttctcccgcaacaatgcactacttgcaagccgaaagatgaagtttcttcag
aggattgcatacctgaacgttggcatttaccccttcacatcaatcttcctcattgtctac
tgcttcctgccagccctgtccctcttctcgggacagttcattgtgcggacgctaaatgtg
accttcctgacctatctgctcgttatcactctgacaatgtgcatgcttgcggtgctcgag
atcaagtggtcaggcatcagcttggaggaatggtggaggaatgagcagttctggctaatc
ggaggaactagcgcccaccttgctgctgttcttcagggtcttctcaaggtgattgctggt
atcgagatctccttcacgctgacatccaaatctggaggagatgaagcagacgacgagttt
gctgatctctacatcgtcaagtggacatcactcatgatcccaccgatcgtcatcatgatg
gttaacctgatcgccatcgctgtcgggttcagcaggacaatatacagtgaaatccctcag
tggagcaagctcctcggcggcgtgttcttcagcttctgggtgctggctcacctttacccc
ttcgccaaggggctaatgggaaggagaggacgaacaccgaccatcgtcttcgtctggtct
ggcctccttgccatcaccatctcattgctgtgggttgccatcaatccgccgtcacagaac
tcgcagataggcggctccttcacattcccctga

Protein

1171 aa

>Os06t0111800-02 Similar to CSLD2 (Fragment).
MASSGGGGLRHSNSSRLSRMSYSGEDGRAQAPGGGGDRPMVTFARRTHSGRYVSYSRDDL
DSELGNSGDMSPESGQEFLNYHVTIPATPDNQPMDPAISARVEEQYVSNSLFTGGFNSVT
RAHLMDKVIESEASHPQMAGAKGSSCAINGCDAKVMSDERGDDILPCECDFKICADCFAD
AVKNGGACPGCKDPYKATELDDVVGARPTLSLPPPPGGLPASRMERRLSIMRSQKAMTRS
QTGDWDHNRWLFETKGTYGYGNAIWPKENEVDNGGGGGGGGGLGGGDGQPAEFTSKPWRP
LTRKLKIPAGVLSPYRLLILIRMAVLGLFLAWRIKHKNEDAMWLWGMSVVCELWFGLSWL
LDQLPKLCPVNRATDLAVLKDKFETPTPSNPNGRSDLPGLDIFVSTADPEKEPPLVTANT
ILSILAADYPVEKLSCYVSDDGGALLTFEAMAEAASFANMWVPFCRKHDIEPRNPESYFN
LKRDPYKNKVRSDFVKDRRRVKREYDEFKVRINSLPDSIRRRSDAYHAREEIKAMKRQRE
AALDDVVEAVKIPKATWMADGTHWPGTWIQPSAEHARGDHAGIIQVMLKPPSDDPLYGTS
GEEGRPLDFTEVDIRLPMLVYVSREKRPGYDHNKKAGAMNALVRSSAVMSNGPFILNLDC
DHYVYNSQAFREGMCFMMDRGGDRIGYVQFPQRFEGIDPSDRYANHNTVFFDVNMRALDG
IMGPVYVGTGCLFRRIALYGFDPPRSKEHSGCCSCCFPQRRKVKTSTVASEERQALRMAD
FDDEEMNMSQFPKKFGNSNFLINSIPIAEFQGRPLADHPGVKNGRPPGALTVPRDLLDAS
TVAEAISVISCWYEDKTEWGQRVGWIYGSVTEDVVTGYRMHNRGWKSVYCVTKRDAFRGT
APINLTDRLHQVLRWATGSVEIFFSRNNALLASRKMKFLQRIAYLNVGIYPFTSIFLIVY
CFLPALSLFSGQFIVRTLNVTFLTYLLVITLTMCMLAVLEIKWSGISLEEWWRNEQFWLI
GGTSAHLAAVLQGLLKVIAGIEISFTLTSKSGGDEADDEFADLYIVKWTSLMIPPIVIMM
VNLIAIAVGFSRTIYSEIPQWSKLLGGVFFSFWVLAHLYPFAKGLMGRRGRTPTIVFVWS
GLLAITISLLWVAINPPSQNSQIGGSFTFP*

5'UTR

chr06:665091..665281 (- strand) : 191 bp

chr06:664646..664669 (- strand) : 24 bp

CDS

chr06:663699..664645 (- strand) : 947 bp

chr06:662576..663383 (- strand) : 808 bp

chr06:660509..662266 (- strand) : 1758 bp

3'UTR

chr06:660148..660508 (- strand) : 361 bp

FASTA

>Os06t0111800-02 class=Sequence position=chr06:660148..665281 (- strand)
ATCAATTGCT AACACGAGTA GTCTATCATC ATTAACTCGC ATCCCTTCCC CTTCCATTGC TCATTGTCTT TCCATTCATA
CGGTGTTGTG TTGTTGTGGC CCAAGAAGAA GAACAAGTAC ACCACACGCC ATTACTCCCA TCTCTCTTAC TCCTCCTCGA
GTTTGATTGA TTCGAGTGGT CGCATCGCAT GGTAAGAAAA CCATTTCCAT CCATCTGATC TGATGAATCT GTGGGCTGTT
CTCTGGTTTT TGAATCGGTC AGTCTGCGTT TGCCGGCGGT GTTGGATTTA GGGTTGAGTG AACACTGAAT TTATCTCTTC
GGATTCCATT CGATTTTTTT TATGCTTCTT GCTTCGTGTT CTGTGGGCGA CGGCGACAAG GTTTTGCTGC TCAGATTTGT
TCTTCCCTTT TGCTTTCCAA AGTTTGAATC TTGGGTTTGG GTCCCGGGAT TTCAGCCTAT TCTCTCGCTG CCTGTCTGAT
TCTGATTTCT TTCCAAAGAC GGGAATCTTC GAGCACAAAT CTGCCATTTT TATCCTCGTA CGCGATAAAG ACTAGCTCTT
TAATTTTCCG ATCCCCACCT CGCGATGCTG ATTTGGTTCC TTCGATTCGC AGATCAGAAA GTGAGGCGAT CGATccatgg
cttccagcgg cggcggcggc ctgcgtcaca gcaacagcag ccgcctctcg cgcatgtcct actccggcga ggacggccgc
gctcaggccc ccggcggcgg cggcgaccgg ccgatggtga cgttcgcccg ccgcacccac tcggggcgct acgtgagcta
ctcccgcgac gacctcgaca gcgagctcgg caacagcggc gacatgtcgc cggagtctgg gcaggagttc ctcaactacc
acgtgacgat cccggcgacg ccggacaacc agccgatgga cccggccatc tcggcgcgcg tggaggagca gtacgtctcc
aactcgctct tcaccggcgg cttcaacagc gtcacgcggg cgcacctcat ggacaaggtg atcgagtcgg aggccagcca
cccgcagatg gccggcgcca agggctcctc ctgcgccatc aacggctgcg acgccaaggt catgagcgac gagcgcggcg
acgacatcct cccctgcgag tgcgacttca agatctgcgc cgactgcttc gccgacgccg tcaagaacgg cggcgcctgc
cccggctgca aggaccccta caaggccacc gagctcgacg acgtggtcgg tgcgaggccg acgctgtcgc tgcctccgcc
gcccggtggc ttgccggcgt cgaggatgga gaggcggctg tcgataatgc ggtcgcagaa ggccatgacc aggagccaga
ccggcgattg ggatcacaat cggtggctgt tcgagaccaa ggggacatac gggtatggca atgccatttg gcccaaggag
aacgaggtcg acaatggcgg tggcggtggc ggaggcggcg ggctgggtgg aggcgacggc cagccggcag agttcacgag
caagccatgg aggccgctca ctcgcaagct caagattcct gcgggtgtcc ttagcccata caggtgaatg gctcacatgt
ccatccatgt gctcacattt gactgattgg atccgttgat ctggtagaaa gtactatatt gttttgagat gcatttgatt
tgtttagtgt tggaaatgaa actaaaaaac aaacctggat ttgtagatat atactcccag ctgttagatc tctgctcaat
agataaatat gttagctgac ttgttagatc tgttctattt cctctgatct ctccagcttc caaacaaata cacaatatta
tagctaatct tataattcag tttatagatg ctaaccttag tttggttgtt ccatgcaggc ttcttattct tattcgtatg
gctgttcttg gtctattcct tgcatggaga attaagcaca agaatgagga tgcaatgtgg ctatggggca tgtctgttgt
ttgcgaactc tggtttggcc tctcttggct cttggatcag ctgccaaagt tgtgccctgt taaccgagca actgaccttg
ctgtcctgaa agataagttt gagaccccga cgccatcaaa tcctaacgga agatctgacc tgccggggct cgatatattt
gtgtctactg ctgatccaga aaaagaaccc ccattggtca cagcaaatac tattctgtcc atccttgctg ctgattatcc
tgttgagaag ctttcttgct atgtttctga tgatggaggc gctctcctga catttgaagc aatggctgaa gccgctagct
ttgcaaacat gtgggttcct ttctgtcgca aacatgacat tgagcctcgc aacccagaga gctactttaa tctgaagagg
gacccataca agaacaaggt ccgttctgat tttgtcaagg acagaagaag ggtgaagagg gagtacgacg agttcaaggt
caggatcaat agcttgcctg attcaatccg tcgccgctcc gatgcatatc atgccaggga ggaaatcaag gccatgaagc
ggcaacgaga ggctgctctc gatgacgtgg tggaggctgt taaaatccct aaagctacct ggatggctga tggcacgcat
tggcctggta cctggattca gccctctgct gagcatgctc ggggtgacca tgctggaata attcaggtag acattcttac
atcacctttc tccttgcttt tcatatatgg cttttcacat tcttacatca cctttctcct tgcttttcat atatggcttg
caatcgaaat atattagcta gctgcatata aacagtattg cacgtttgca caaatgatta ctgttcattt ttgttttttc
ccttgagcag aagcatgtgc atccttttta ccgttttaat atctagcagt atctctatgg ggcttgcctc tatctatctt
gtagtagtga accaggaaaa tgccacctgt ttgatcattg ccgtattgtg ttcaggtaat gctgaaacct cctagtgatg
atcccttgta tggaaccagc ggtgaagaag gcagacctct tgatttcact gaggttgaca tccgtttgcc aatgttggtc
tatgtgtccc gagagaagcg tcctggttat gatcacaaca agaaggctgg tgcgatgaat gcgttggtcc gctcatctgc
tgtcatgtca aatggacctt tcatcctcaa ccttgattgt gatcactatg tttacaactc acaagctttc cgtgaaggca
tgtgcttcat gatggatcgt ggtggtgacc gtattggcta tgtccagttc cctcaacggt ttgagggcat tgatccatca
gatcgatatg ctaaccacaa cactgtcttc ttcgatgtca acatgcgtgc acttgatggt atcatgggac cagtctacgt
cggcactgga tgtcttttcc gtcgcatcgc tttgtatgga tttgacccac cgcgctccaa ggaacatagt ggttgctgca
gctgttgctt cccccagagg cgcaaggtta aaacttccac agttgcatct gaagagaggc aggctttgag aatggcagat
tttgatgatg aggaaatgaa catgtcacaa tttcccaaga agttcggtaa ttcaaacttc ctcatcaact ctatcccaat
tgctgaattc caagggcgac ctcttgctga ccatcctgga gtcaaaaatg gacgtcctcc tggtgctctc accgtccctc
gcgaccttct cgatgcttcc acagttgctg aggctatcag tgtcatctca tgctggtatg aagataagac tgagtggggt
cagcgtgttg gatggatcta tggttcagtc acagaggatg tggtcactgg ttacaggatg cacaaccgtg gatggaaatc
agtttactgt gtcaccaaac gtgatgcttt ccgtggcact gcaccaatca accttactga ccgtcttcat caggtgctcc
ggtgggctac tggttcagtg gaaatcttct tctcccgcaa caatgcacta cttgcaagcc gaaagatgaa gtttcttcag
aggattgcat acctgaacgt tggcatttac cccttcacat caatcttcct cattgtctac tgcttcctgc cagccctgtc
cctcttctcg ggacagttca ttgtgcggac gctaaatgtg accttcctga cctatctgct cgttatcact ctgacaatgt
gcatgcttgc ggtgctcgag atcaagtggt caggcatcag cttggaggaa tggtggagga atgagcagtt ctggctaatc
ggaggaacta gcgcccacct tgctgctgtt cttcagggtc ttctcaaggt gattgctggt atcgagatct ccttcacgct
gacatccaaa tctggaggag atgaagcaga cgacgagttt gctgatctct acatcgtcaa gtggacatca ctcatgatcc
caccgatcgt catcatgatg gttaacctga tcgccatcgc tgtcgggttc agcaggacaa tatacagtga aatccctcag
tggagcaagc tcctcggcgg cgtgttcttc agcttctggg tgctggctca cctttacccc ttcgccaagg ggctaatggg
aaggagagga cgaacaccga ccatcgtctt cgtctggtct ggcctccttg ccatcaccat ctcattgctg tgggttgcca
tcaatccgcc gtcacagaac tcgcagatag gcggctcctt cacattcccc tgagcttcct catgaacatg aaccttttgt
atgatgaatt ataagagtgg tcccagtagc agttgtcctt gctgttggac aagtaaattc tttacctatg tttacttagg
tttttctttt ttttttgggt cgaagatgat actattatga atcatgcatg atactagttc ttttgttcgt ttTTGTGCCA
AAATGAGAAG AGGTTCTGTT TGGACCTGAA CATCAATCAA TTGCAAAAAT TCGGAGACTA GGAAGTTCAG AGTTGCACTC
CTGCACTTCT TTGGAGCTCT TCCATTCTGC ATAACTGCGC TGTCTACTTG TATTGCATTT GCCTACTCTT AATCCTTCAC
TTTGCAGTAG TACT

Locus: Os06g0111800

Loading...

Locus: Os06g0111800

Loading...