Os06t0111800-03

Locus

Os06g0111800

Description

Similar to cDNA clone:001-123-B04, full insert sequence.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLD2, CSLD2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE D2, CELLULOSE SYNTHASE LIKE D2

Oryzabase Gene Symbol Synonym(s)

OsCSLD2, OsCslD2, OsCSLD2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK102695 (DDBJ, Best hit)

Protein Evidence

B7EXX7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cellulose biosynthetic process (GO:0030244)

Cellular Component: membrane (GO:0016020)

Molecular Function: cellulose synthase (UDP-forming) activity (GO:0016760)

Functional domain (InterPro)

Cellulose synthase (IPR005150)

Full-length cDNA

J033103F21 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0111800-03)

RiceXPro (AK102695)

Others

Oryzabase (13897)

Oryzabase (9013)

KEGG (Os06t0111800-03)

Transcript

2752 bp

>Os06t0111800-03 Similar to cDNA clone:001-123-B04, full insert sequence.
tattccttgcatggagaattaagcacaagaatgaggatgcaatgtggctatggggcatgt
ctgttgtttgcgaactctggtttggcctctcttggctcttggatcagctgccaaagttgt
gccctgttaaccgagcaactgaccttgctgtcctgaaagataagtttgagaccccgacgc
catcaaatcctaacggaagatctgacctgccggggctcgatatatttgtgtctactgctg
atccagaaaaagaacccccattggtcacagcaaatactattctgtccatccttgctgctg
attatcctgttgagaagctttcttgctatgtttctgatgatggaggcgctctcctgacat
ttgaagcaatggctgaagccgctagctttgcaaacatgtgggttcctttctgtcgcaaac
atgacattgagcctcgcaacccagagagctactttaatctgaagagggacccatacaaga
acaaggtccgttctgattttgtcaaggacagaagaagggtgaagagggagtacgacgagt
tcaaggtcaggatcaatagcttgcctgattcaatccgtcgccgctccgatgcatatcatg
ccagggaggaaatcaaggccatgaagcggcaacgagaggctgctctcgatgacgtggtgg
aggctgttaaaatccctaaagctacctggatggctgatggcacgcattggcctggtacct
ggattcagccctctgctgagcatgctcggggtgaccatgctggaataattcaggtaatgc
tgaaacctcctagtgatgatcccttgtatggaaccagcggtgaagaaggcagacctcttg
atttcactgaggttgacatccgtttgccaatgttggtctatgtgtcccgagagaagcgtc
ctggttatgatcacaacaagaaggctggtgcgatgaatgcgttggtccgctcatctgctg
tcatgtcaaatggacctttcatcctcaaccttgattgtgatcactatgtttacaactcac
aagctttccgtgaaggcatgtgcttcatgatggatcgtggtggtgaccgtattggctatg
tccagttccctcaacggtttgagggcattgatccatcagatcgatatgctaaccacaaca
ctgtcttcttcgatgtcaacatgcgtgcacttgatggtatcatgggaccagtctacgtcg
gcactggatgtcttttccgtcgcatcgctttgtatggatttgacccaccgcgctccaagg
aacatagtggttgctgcagctgttgcttcccccagaggcgcaaggttaaaacttccacag
ttgcatctgaagagaggcaggctttgagaatggcagattttgatgatgaggaaatgaaca
tgtcacaatttcccaagaagttcggtaattcaaacttcctcatcaactctatcccaattg
ctgaattccaagggcgacctcttgctgaccatcctggagtcaaaaatggacgtcctcctg
gtgctctcaccgtccctcgcgaccttctcgatgcttccacagttgctgaggctatcagtg
tcatctcatgctggtatgaagataagactgagtggggtcagcgtgttggatggatctatg
gttcagtcacagaggatgtggtcactggttacaggatgcacaaccgtggatggaaatcag
tttactgtgtcaccaaacgtgatgctttccgtggcactgcaccaatcaaccttactgacc
gtcttcatcaggtgctccggtgggctactggttcagtggaaatcttcttctcccgcaaca
atgcactacttgcaagccgaaagatgaagtttcttcagaggattgcatacctgaacgttg
gcatttaccccttcacatcaatcttcctcattgtctactgcttcctgccagccctgtccc
tcttctcgggacagttcattgtgcggacgctaaatgtgaccttcctgacctatctgctcg
ttatcactctgacaatgtgcatgcttgcggtgctcgagatcaagtggtcaggcatcagct
tggaggaatggtggaggaatgagcagttctggctaatcggaggaactagcgcccaccttg
ctgctgttcttcagggtcttctcaaggtgattgctggtatcgagatctccttcacgctga
catccaaatctggaggagatgaagcagacgacgagtttgctgatctctacatcgtcaagt
ggacatcactcatgatcccaccgatcgtcatcatgatggttaacctgatcgccatcgctg
tcgggttcagcaggacaatatacagtgaaatccctcagtggagcaagctcctcggcggcg
tgttcttcagcttctgggtgctggctcacctttaccccttcgccaaggggctaatgggaa
ggagaggacgaacaccgaccatcgtcttcgtctggtctggcctccttgccatcaccatct
cattgctgtgggttgccatcaatccgccgtcacagaactcgcagataggcggctccttca
cattcccctgagcttcctcatgaacatgaaccttttgtatgatgaattataagagtggtc
ccagtagcagttgtccttgctgttggacaagtaaattctttacctatgtttacttaggtt
tttcttttttttttgggtcgaagatgatactattatgaatcatgcatgatactagttctt
ttgttcgtttTTGTGCCAAAATGAGAAGAGGTTCTGTTTGGACCTGAACATC

CDS

2529 bp

>Os06t0111800-03 Similar to cDNA clone:001-123-B04, full insert sequence.
ttccttgcatggagaattaagcacaagaatgaggatgcaatgtggctatggggcatgtct
gttgtttgcgaactctggtttggcctctcttggctcttggatcagctgccaaagttgtgc
cctgttaaccgagcaactgaccttgctgtcctgaaagataagtttgagaccccgacgcca
tcaaatcctaacggaagatctgacctgccggggctcgatatatttgtgtctactgctgat
ccagaaaaagaacccccattggtcacagcaaatactattctgtccatccttgctgctgat
tatcctgttgagaagctttcttgctatgtttctgatgatggaggcgctctcctgacattt
gaagcaatggctgaagccgctagctttgcaaacatgtgggttcctttctgtcgcaaacat
gacattgagcctcgcaacccagagagctactttaatctgaagagggacccatacaagaac
aaggtccgttctgattttgtcaaggacagaagaagggtgaagagggagtacgacgagttc
aaggtcaggatcaatagcttgcctgattcaatccgtcgccgctccgatgcatatcatgcc
agggaggaaatcaaggccatgaagcggcaacgagaggctgctctcgatgacgtggtggag
gctgttaaaatccctaaagctacctggatggctgatggcacgcattggcctggtacctgg
attcagccctctgctgagcatgctcggggtgaccatgctggaataattcaggtaatgctg
aaacctcctagtgatgatcccttgtatggaaccagcggtgaagaaggcagacctcttgat
ttcactgaggttgacatccgtttgccaatgttggtctatgtgtcccgagagaagcgtcct
ggttatgatcacaacaagaaggctggtgcgatgaatgcgttggtccgctcatctgctgtc
atgtcaaatggacctttcatcctcaaccttgattgtgatcactatgtttacaactcacaa
gctttccgtgaaggcatgtgcttcatgatggatcgtggtggtgaccgtattggctatgtc
cagttccctcaacggtttgagggcattgatccatcagatcgatatgctaaccacaacact
gtcttcttcgatgtcaacatgcgtgcacttgatggtatcatgggaccagtctacgtcggc
actggatgtcttttccgtcgcatcgctttgtatggatttgacccaccgcgctccaaggaa
catagtggttgctgcagctgttgcttcccccagaggcgcaaggttaaaacttccacagtt
gcatctgaagagaggcaggctttgagaatggcagattttgatgatgaggaaatgaacatg
tcacaatttcccaagaagttcggtaattcaaacttcctcatcaactctatcccaattgct
gaattccaagggcgacctcttgctgaccatcctggagtcaaaaatggacgtcctcctggt
gctctcaccgtccctcgcgaccttctcgatgcttccacagttgctgaggctatcagtgtc
atctcatgctggtatgaagataagactgagtggggtcagcgtgttggatggatctatggt
tcagtcacagaggatgtggtcactggttacaggatgcacaaccgtggatggaaatcagtt
tactgtgtcaccaaacgtgatgctttccgtggcactgcaccaatcaaccttactgaccgt
cttcatcaggtgctccggtgggctactggttcagtggaaatcttcttctcccgcaacaat
gcactacttgcaagccgaaagatgaagtttcttcagaggattgcatacctgaacgttggc
atttaccccttcacatcaatcttcctcattgtctactgcttcctgccagccctgtccctc
ttctcgggacagttcattgtgcggacgctaaatgtgaccttcctgacctatctgctcgtt
atcactctgacaatgtgcatgcttgcggtgctcgagatcaagtggtcaggcatcagcttg
gaggaatggtggaggaatgagcagttctggctaatcggaggaactagcgcccaccttgct
gctgttcttcagggtcttctcaaggtgattgctggtatcgagatctccttcacgctgaca
tccaaatctggaggagatgaagcagacgacgagtttgctgatctctacatcgtcaagtgg
acatcactcatgatcccaccgatcgtcatcatgatggttaacctgatcgccatcgctgtc
gggttcagcaggacaatatacagtgaaatccctcagtggagcaagctcctcggcggcgtg
ttcttcagcttctgggtgctggctcacctttaccccttcgccaaggggctaatgggaagg
agaggacgaacaccgaccatcgtcttcgtctggtctggcctccttgccatcaccatctca
ttgctgtgggttgccatcaatccgccgtcacagaactcgcagataggcggctccttcaca
ttcccctga

Protein

843 aa

>Os06t0111800-03 Similar to cDNA clone:001-123-B04, full insert sequence.
FLAWRIKHKNEDAMWLWGMSVVCELWFGLSWLLDQLPKLCPVNRATDLAVLKDKFETPTP
SNPNGRSDLPGLDIFVSTADPEKEPPLVTANTILSILAADYPVEKLSCYVSDDGGALLTF
EAMAEAASFANMWVPFCRKHDIEPRNPESYFNLKRDPYKNKVRSDFVKDRRRVKREYDEF
KVRINSLPDSIRRRSDAYHAREEIKAMKRQREAALDDVVEAVKIPKATWMADGTHWPGTW
IQPSAEHARGDHAGIIQVMLKPPSDDPLYGTSGEEGRPLDFTEVDIRLPMLVYVSREKRP
GYDHNKKAGAMNALVRSSAVMSNGPFILNLDCDHYVYNSQAFREGMCFMMDRGGDRIGYV
QFPQRFEGIDPSDRYANHNTVFFDVNMRALDGIMGPVYVGTGCLFRRIALYGFDPPRSKE
HSGCCSCCFPQRRKVKTSTVASEERQALRMADFDDEEMNMSQFPKKFGNSNFLINSIPIA
EFQGRPLADHPGVKNGRPPGALTVPRDLLDASTVAEAISVISCWYEDKTEWGQRVGWIYG
SVTEDVVTGYRMHNRGWKSVYCVTKRDAFRGTAPINLTDRLHQVLRWATGSVEIFFSRNN
ALLASRKMKFLQRIAYLNVGIYPFTSIFLIVYCFLPALSLFSGQFIVRTLNVTFLTYLLV
ITLTMCMLAVLEIKWSGISLEEWWRNEQFWLIGGTSAHLAAVLQGLLKVIAGIEISFTLT
SKSGGDEADDEFADLYIVKWTSLMIPPIVIMMVNLIAIAVGFSRTIYSEIPQWSKLLGGV
FFSFWVLAHLYPFAKGLMGRRGRTPTIVFVWSGLLAITISLLWVAINPPSQNSQIGGSFT
FP*

5'UTR

chr06:663347..663348 (- strand) : 2 bp

CDS

chr06:662576..663346 (- strand) : 771 bp

chr06:660509..662266 (- strand) : 1758 bp

3'UTR

chr06:660288..660508 (- strand) : 221 bp

FASTA

>Os06t0111800-03 class=Sequence position=chr06:660288..663348 (- strand)
tattccttgc atggagaatt aagcacaaga atgaggatgc aatgtggcta tggggcatgt ctgttgtttg cgaactctgg
tttggcctct cttggctctt ggatcagctg ccaaagttgt gccctgttaa ccgagcaact gaccttgctg tcctgaaaga
taagtttgag accccgacgc catcaaatcc taacggaaga tctgacctgc cggggctcga tatatttgtg tctactgctg
atccagaaaa agaaccccca ttggtcacag caaatactat tctgtccatc cttgctgctg attatcctgt tgagaagctt
tcttgctatg tttctgatga tggaggcgct ctcctgacat ttgaagcaat ggctgaagcc gctagctttg caaacatgtg
ggttcctttc tgtcgcaaac atgacattga gcctcgcaac ccagagagct actttaatct gaagagggac ccatacaaga
acaaggtccg ttctgatttt gtcaaggaca gaagaagggt gaagagggag tacgacgagt tcaaggtcag gatcaatagc
ttgcctgatt caatccgtcg ccgctccgat gcatatcatg ccagggagga aatcaaggcc atgaagcggc aacgagaggc
tgctctcgat gacgtggtgg aggctgttaa aatccctaaa gctacctgga tggctgatgg cacgcattgg cctggtacct
ggattcagcc ctctgctgag catgctcggg gtgaccatgc tggaataatt caggtagaca ttcttacatc acctttctcc
ttgcttttca tatatggctt ttcacattct tacatcacct ttctccttgc ttttcatata tggcttgcaa tcgaaatata
ttagctagct gcatataaac agtattgcac gtttgcacaa atgattactg ttcatttttg ttttttccct tgagcagaag
catgtgcatc ctttttaccg ttttaatatc tagcagtatc tctatggggc ttgcctctat ctatcttgta gtagtgaacc
aggaaaatgc cacctgtttg atcattgccg tattgtgttc aggtaatgct gaaacctcct agtgatgatc ccttgtatgg
aaccagcggt gaagaaggca gacctcttga tttcactgag gttgacatcc gtttgccaat gttggtctat gtgtcccgag
agaagcgtcc tggttatgat cacaacaaga aggctggtgc gatgaatgcg ttggtccgct catctgctgt catgtcaaat
ggacctttca tcctcaacct tgattgtgat cactatgttt acaactcaca agctttccgt gaaggcatgt gcttcatgat
ggatcgtggt ggtgaccgta ttggctatgt ccagttccct caacggtttg agggcattga tccatcagat cgatatgcta
accacaacac tgtcttcttc gatgtcaaca tgcgtgcact tgatggtatc atgggaccag tctacgtcgg cactggatgt
cttttccgtc gcatcgcttt gtatggattt gacccaccgc gctccaagga acatagtggt tgctgcagct gttgcttccc
ccagaggcgc aaggttaaaa cttccacagt tgcatctgaa gagaggcagg ctttgagaat ggcagatttt gatgatgagg
aaatgaacat gtcacaattt cccaagaagt tcggtaattc aaacttcctc atcaactcta tcccaattgc tgaattccaa
gggcgacctc ttgctgacca tcctggagtc aaaaatggac gtcctcctgg tgctctcacc gtccctcgcg accttctcga
tgcttccaca gttgctgagg ctatcagtgt catctcatgc tggtatgaag ataagactga gtggggtcag cgtgttggat
ggatctatgg ttcagtcaca gaggatgtgg tcactggtta caggatgcac aaccgtggat ggaaatcagt ttactgtgtc
accaaacgtg atgctttccg tggcactgca ccaatcaacc ttactgaccg tcttcatcag gtgctccggt gggctactgg
ttcagtggaa atcttcttct cccgcaacaa tgcactactt gcaagccgaa agatgaagtt tcttcagagg attgcatacc
tgaacgttgg catttacccc ttcacatcaa tcttcctcat tgtctactgc ttcctgccag ccctgtccct cttctcggga
cagttcattg tgcggacgct aaatgtgacc ttcctgacct atctgctcgt tatcactctg acaatgtgca tgcttgcggt
gctcgagatc aagtggtcag gcatcagctt ggaggaatgg tggaggaatg agcagttctg gctaatcgga ggaactagcg
cccaccttgc tgctgttctt cagggtcttc tcaaggtgat tgctggtatc gagatctcct tcacgctgac atccaaatct
ggaggagatg aagcagacga cgagtttgct gatctctaca tcgtcaagtg gacatcactc atgatcccac cgatcgtcat
catgatggtt aacctgatcg ccatcgctgt cgggttcagc aggacaatat acagtgaaat ccctcagtgg agcaagctcc
tcggcggcgt gttcttcagc ttctgggtgc tggctcacct ttaccccttc gccaaggggc taatgggaag gagaggacga
acaccgacca tcgtcttcgt ctggtctggc ctccttgcca tcaccatctc attgctgtgg gttgccatca atccgccgtc
acagaactcg cagataggcg gctccttcac attcccctga gcttcctcat gaacatgaac cttttgtatg atgaattata
agagtggtcc cagtagcagt tgtccttgct gttggacaag taaattcttt acctatgttt acttaggttt ttcttttttt
tttgggtcga agatgatact attatgaatc atgcatgata ctagttcttt tgttcgtttT TGTGCCAAAA TGAGAAGAGG
TTCTGTTTGG ACCTGAACAT C

Locus: Os06g0111800

Loading...

Locus: Os06g0111800

Loading...