Os06t0112200-01

Locus

Os06g0112200

Description

5'-methylthioadenosine nucleosidase, Submergence-induced ethylene synthesis

RAP-DB Gene Symbol Synonym(s)

OsMTN

RAP-DB Gene Name Synonym(s)

methylthioadenosine nucleosidase

CGSNL Gene Symbol

MTN

CGSNL Gene Name

METHYLTHIOADENOSINE/S-ADENOSYL HOMOCYSTEINE NUCLEOSIDASE

Oryzabase Gene Symbol Synonym(s)

OsMTN

Oryzabase Gene Name Synonym(s)

Methylthioadenosine/S-adenosyl homocysteine nucleosidase, 5'-methylthioadenosine nucleosidase, MTA nucleosidase

Transcript Evidence

AK066172

AK104481

AK104797

Protein Evidence

Q9LHZ0

Q8W162

Literature

PMID: 17339651

Note

Manual Curation

April 5, 2021

Gene Ontology (GO)

Biological Process: nucleoside metabolic process (GO:0009116)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Nucleoside phosphorylase superfamily (IPR035994)

Nucleoside phosphorylase domain (IPR000845)

Full-length cDNA

J013056A05 (Online Clone Ordering)

006-301-G11 (Online Clone Ordering)

001-039-H06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0112200-01)

Others

Oryzabase (11129)

Transcript

1139 bp

>Os06t0112200-01 5'-methylthioadenosine nucleosidase, Submergence-induced ethylene synthesis
accgcctctctctcctcccccaccacgcggcggcggcagcagcagcagctAGGGTTTAGA
GAGCAGCCCCCAATCCCATGGCCCCGCCCTCCGACTCCGACGACTCGGCCCCGATCCCCG
CCGGCGCCATCTCCAAGCTCCTCATCGTCATAGCGATGCAGACGGAGGCGCTCCCGCTCG
TCAACAAGTTCCACCTCGTCGAGGCGGAGGAATCCATATTTCCTAAAGGTGCCCCATGGA
TTAGATACCATGGCAACTACAAAGGCCTTCACGTTGACCTTGTATGGCCTGGAAAAGATC
CTGTTCTCGGAGTTGACTGTGTTGGCACGGTATCAGCAGCACTTGTGACTTATGCTTCTA
TTCAGTCATTGAAGCCAGATCTGATCATCAATGCTGGCACTGCTGGTGGGTTTAAGGCCA
AAGGAGCAGACATTGGAGATGTCTACTTAGCATCCGATGTTGCATTCCACGATAGGAGAA
TACCTATCCCTGTCTTCGACATGTATGGAATTGGAACACGAAAAACATTTGCTACCCCTA
ATATATTGAAGGAACTCAATTTGAAGGTTGGGAAGCTCTCAACTGGCGATTCTCTAGATA
TGTCTCCCCATGACGAGTCAGCAATATTGAACAATGATGCTACAGTCAAGGATATGGAGG
GAGCCGCGGTGGCATATGTTGCTGACATGTTTTCAACACCGGCAATCTTTGTGAAAGCTG
TGACTGATATTGTTGATGGGGAGAAACCAACAGCCGAGGAGTTTCTGCAGAACCTGGTTG
CTGTGACAGCAGCTCTGGACAAGGCAGTTACAGAAGTGGTTGATTTCATCAGTGGGAAAT
GCATATCGGATCTTTGAATGATGAAGCTTAGAAACCTGTTCATCAAATCCAAGCTCTGCT
GCTTCAATGCACTATACTATACTACATCACTGCTGTATGATTTTTCATGGGGATGCGTAT
ACAATTTTTAGGTTCCCCTGAGGCCCTGATCCCCCGTATGTACAAAATTCTTGGCAATTA
CTTGGATCAATAGCGTGGAATTTTGTAGAATATTCTGCAAAATGTGCAGTGTAATGAAAC
TAAATAAGGTGATATTCTGTCAAACTAAGATAAGTGGTGGGCGGTGGAGTTATTTTCTT

CDS

780 bp

>Os06t0112200-01 5'-methylthioadenosine nucleosidase, Submergence-induced ethylene synthesis
ATGGCCCCGCCCTCCGACTCCGACGACTCGGCCCCGATCCCCGCCGGCGCCATCTCCAAG
CTCCTCATCGTCATAGCGATGCAGACGGAGGCGCTCCCGCTCGTCAACAAGTTCCACCTC
GTCGAGGCGGAGGAATCCATATTTCCTAAAGGTGCCCCATGGATTAGATACCATGGCAAC
TACAAAGGCCTTCACGTTGACCTTGTATGGCCTGGAAAAGATCCTGTTCTCGGAGTTGAC
TGTGTTGGCACGGTATCAGCAGCACTTGTGACTTATGCTTCTATTCAGTCATTGAAGCCA
GATCTGATCATCAATGCTGGCACTGCTGGTGGGTTTAAGGCCAAAGGAGCAGACATTGGA
GATGTCTACTTAGCATCCGATGTTGCATTCCACGATAGGAGAATACCTATCCCTGTCTTC
GACATGTATGGAATTGGAACACGAAAAACATTTGCTACCCCTAATATATTGAAGGAACTC
AATTTGAAGGTTGGGAAGCTCTCAACTGGCGATTCTCTAGATATGTCTCCCCATGACGAG
TCAGCAATATTGAACAATGATGCTACAGTCAAGGATATGGAGGGAGCCGCGGTGGCATAT
GTTGCTGACATGTTTTCAACACCGGCAATCTTTGTGAAAGCTGTGACTGATATTGTTGAT
GGGGAGAAACCAACAGCCGAGGAGTTTCTGCAGAACCTGGTTGCTGTGACAGCAGCTCTG
GACAAGGCAGTTACAGAAGTGGTTGATTTCATCAGTGGGAAATGCATATCGGATCTTTGA

Protein

260 aa

>Os06t0112200-01 5'-methylthioadenosine nucleosidase, Submergence-induced ethylene synthesis
MAPPSDSDDSAPIPAGAISKLLIVIAMQTEALPLVNKFHLVEAEESIFPKGAPWIRYHGN
YKGLHVDLVWPGKDPVLGVDCVGTVSAALVTYASIQSLKPDLIINAGTAGGFKAKGADIG
DVYLASDVAFHDRRIPIPVFDMYGIGTRKTFATPNILKELNLKVGKLSTGDSLDMSPHDE
SAILNNDATVKDMEGAAVAYVADMFSTPAIFVKAVTDIVDGEKPTAEEFLQNLVAVTAAL
DKAVTEVVDFISGKCISDL*

5'UTR

chr06:692774..692850 (+ strand) : 77 bp

CDS

chr06:692851..692926 (+ strand) : 76 bp

chr06:693009..693072 (+ strand) : 64 bp

chr06:693521..693612 (+ strand) : 92 bp

chr06:693736..693842 (+ strand) : 107 bp

chr06:693931..694005 (+ strand) : 75 bp

chr06:694399..694473 (+ strand) : 75 bp

chr06:694699..694791 (+ strand) : 93 bp

chr06:695176..695373 (+ strand) : 198 bp

3'UTR

chr06:695374..695655 (+ strand) : 282 bp

FASTA

>Os06t0112200-01 class=Sequence position=chr06:692774..695655 (+ strand)
accgcctctc tctcctcccc caccacgcgg cggcggcagc agcagcagct AGGGTTTAGA GAGCAGCCCC CAATCCCATG
GCCCCGCCCT CCGACTCCGA CGACTCGGCC CCGATCCCCG CCGGCGCCAT CTCCAAGCTC CTCATCGTCA TAGGTACTCT
CAATCCTCAT CCCCTCCTGC GCTTCTGCTT CTTGTTGCTA ATCCCGTTGC TGTTGTTTGG TTGGTTTGGC TTCAGCGATG
CAGACGGAGG CGCTCCCGCT CGTCAACAAG TTCCACCTCG TCGAGGCGGA GGAATCCATG TTAGTAGTGT TCTCCCGTTT
CTCCCCCCTT GTTCCTCTTC ACCAACCATT TCCTATCCTT CCATGCCATG CTGCACTTAC TGCTGTTGGG TGGTTATAAG
TTAAATCCCT GGAATTAGGA TTTTTTTTAA AAAAAAAGAA AAGAAAAAAG AACAAGTTAT TTTTGTGGAT GGTGATGTTC
TGCTTTACTA GGCAAGTTTA GTGGCAACCT TCGTTTAATC TGTCTCATGA AAATGTCAAT GTCAGCTGTC CTCGAAACTT
TTGGAAATAA TTATATCCAA CTTACAGGGA TAGTCTGATA CGATCCGTTT TCACTATTCC TGTTCCTGTG TCCTTCATAC
ATAAATTAAG CTTTAACCTT GTGTCATCAC CCTGTTTTGC TCATATAACC TGTCCGATAC TCTCAGCTCT GAAGCTAACT
CCTACCTTTG TGGCACACGC CTAACAGATT TCCTAAAGGT GCCCCATGGA TTAGATACCA TGGCAACTAC AAAGGCCTTC
ACGTTGACCT TGTATGGCCT GGAAAAGATC CTGTTCTCGG TAAGTTGTCA TCTATAATAT GCTGCTCACC AGCTTGTTGT
CAAGAATCAA GCAATAATTT GATAGGTTTC TTCATCATGT AATTCTTACA ATTTATCCAC AAACTAACCT TATTTCTTTC
AGGAGTTGAC TGTGTTGGCA CGGTATCAGC AGCACTTGTG ACTTATGCTT CTATTCAGTC ATTGAAGCCA GATCTGATCA
TCAATGCTGG CACTGCTGGT GGGTTTAAGG TAATGTTTCA AGATATCACA TGTTTGATGC CATGCTGTCG TTTTATTGTA
CCTGGGTTCT GATGTTGTTT CCCTTCTGGT CTTTCAGGCC AAAGGAGCAG ACATTGGAGA TGTCTACTTA GCATCCGATG
TTGCATTCCA CGATAGGAGA ATACCTATCC CTGTGAGTGT TCTGTTATGT CTTGTAGTAT TTTTTTTTGT GGACCTAGTC
CCATTTTTCT GCAGTGTGAC CTTATTCAGT TCATTGATGT GCTACATTAT TAGAATTCAG AAAGTCATAC ATGTCTTGAA
CAAAACATTG CTAGTTTTTA TCTGTTTATT TCATAATCCA GTCCGTTTCA TGGTTTTCTA ATTCTACCTT CCTGCACCGT
GACAACTAAT TATTTATAAA CTTATAGTCT GCTTTACTCA CTTGTGCTTC TGGTGACATC TGCTCCTTTG CCATTTATTC
TCAAGATATT ATATTTGCAT CGCCATATTT TCTACAAGTT CTTTTTAGAT AATCTATACA CGTTTAATTG AGATGTTGAC
ATGGACCTTC TTGGCTTATC CACAGGTCTT CGACATGTAT GGAATTGGAA CACGAAAAAC ATTTGCTACC CCTAATATAT
TGAAGGAACT CAATTTGAAG GTAAGCTACA GAGCTATGCT AGTTGATGCC AAACTGCTGG AATGAATACT GTGTGAGTCG
TGCTTACATG CATATATCTT ACTGTCTCCT TTAGCATGGT GTTGTTTCTG AAACGAATTT GTGGATTTTA TTGGTAAACT
GTAGCACTGT ATAGACTCAA CAAGATGAGT CGATCACATG CTAGTGTTCA ACATTCCGGA AGTCATTGTG CCTTATTTGC
TTCAGGTTGG GAAGCTCTCA ACTGGCGATT CTCTAGATAT GTCTCCCCAT GACGAGTCAG CAATATTGAA CAATGATGCT
ACAGTCAAGG ATATGGAGGT ATCTATTTAC TTCTGCTCAA GCATTCAGCT TAAGAACATA GGCACACAAC AGGGAAATGG
AGGTCTTCAA CCATAGGTTC CTCTTGGAAG TTGGAATGAG TTCATCCTTT ATGAACTTTA GGACAACTTT TACACATCTT
GCATTTTGTG GGTCGTTATG GCATTGAAGT AGGCAAATGT CTATAGGAAT ATATTTTTAT CCAACTAATT ATTTGCTGAT
CTCTTCAGTT TTTTTGTTAA TGCCTGAGTT CAAGTTAAAT CGACTAGCAT GAATAAGATA CTTTGTGTGC ACTGGTATTC
ATACGAAGTT ATCTGCTGCT CTGCTTTGTT TTCAGTTGTA ATTTGTAGGC TCAAACTGGC TTCGTTATTC TTGTTTTTCC
AGGGAGCCGC GGTGGCATAT GTTGCTGACA TGTTTTCAAC ACCGGCAATC TTTGTGAAAG CTGTGACTGA TATTGTTGAT
GGGGAGAAAC CAACAGCCGA GGAGTTTCTG CAGAACCTGG TTGCTGTGAC AGCAGCTCTG GACAAGGCAG TTACAGAAGT
GGTTGATTTC ATCAGTGGGA AATGCATATC GGATCTTTGA ATGATGAAGC TTAGAAACCT GTTCATCAAA TCCAAGCTCT
GCTGCTTCAA TGCACTATAC TATACTACAT CACTGCTGTA TGATTTTTCA TGGGGATGCG TATACAATTT TTAGGTTCCC
CTGAGGCCCT GATCCCCCGT ATGTACAAAA TTCTTGGCAA TTACTTGGAT CAATAGCGTG GAATTTTGTA GAATATTCTG
CAAAATGTGC AGTGTAATGA AACTAAATAA GGTGATATTC TGTCAAACTA AGATAAGTGG TGGGCGGTGG AGTTATTTTC
TT

Locus: Os06g0112200

Loading...

Locus: Os06g0112200

Loading...