Os06t0114000-01

Locus

Os06g0114000

Description

Hypothetical gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCPn60beta1, OsCPn60b1

Oryzabase Gene Name Synonym(s)

chaperonin 60 beta subunit 1

Transcript Evidence

AK063734 (DDBJ, Best hit)

Protein Evidence

longestORF

Literature

Note

Manual Curation

Full-length cDNA

001-120-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0114000-01)

RiceXPro (AK063734)

Others

Oryzabase (14350)

KEGG (Os06t0114000-01)

Transcript

662 bp

>Os06t0114000-01 Hypothetical gene.
CCCCAAACCCCTCCTCACCCGCAGCGCCCCAACCCAACCCTCCCCGAGGTCGCAGCCTTA
TCCTCTCCTCTCCCCTCCGCGAGGTCAGGTGAGCTCAAACCCTATCCCCTCCTCCTCCAC
CTCCGCCGCTCCTCCCCGCCCCGGGGCGCTGGGTTCTCCCTCTTCCGGTGGCGACGTGGT
GGGGTGTGGTGTGTTGACCCCCGCACGATTCGGTTGCCGCGTGGTTGGAGGATTCGGTGG
ATAGTTCTCGCCGCGCGATTCGTGGGGGGCGGAGAGCTCGAGGTCGCGCCCCCCGCTTGG
TTTTGAGGGGGGCCTTTTGATGGTTGCTCGTGCGGGCTAATTTTGCGCTAGAACTGTTAT
ATCAGTGGAAATTGTTGGTTTAGTTAGCACGGGGACTACAGAATGTATCAGTGGAAATTG
TTGGTTTAGTTAGCACGGGGACTACAGAATGTTGTTGGCTCCAGCGTTCTGTTCGTCTGG
TTGTGACTTTTGGCATGGGGTGTTCTAATTCAGCCAAGTAGAGTGGAGTAGGAGGGTGCA
TGCGATATTCTGTTTGGCAGTTGGAATGCTAGTGTTTTCATGTATGCTAGTGATGGCCAG
CCATTTGAAGCTGACGTAACTGTTAGGGTGGTTGAATGGCAAACATTTAAATTTGAAGGT
GT

CDS

306 bp

>Os06t0114000-01 Hypothetical gene.
CCCCAAACCCCTCCTCACCCGCAGCGCCCCAACCCAACCCTCCCCGAGGTCGCAGCCTTA
TCCTCTCCTCTCCCCTCCGCGAGGTCAGGTGAGCTCAAACCCTATCCCCTCCTCCTCCAC
CTCCGCCGCTCCTCCCCGCCCCGGGGCGCTGGGTTCTCCCTCTTCCGGTGGCGACGTGGT
GGGGTGTGGTGTGTTGACCCCCGCACGATTCGGTTGCCGCGTGGTTGGAGGATTCGGTGG
ATAGTTCTCGCCGCGCGATTCGTGGGGGGCGGAGAGCTCGAGGTCGCGCCCCCCGCTTGG
TTTTGA

Protein

102 aa

>Os06t0114000-01 Hypothetical gene.
PQTPPHPQRPNPTLPEVAALSSPLPSARSGELKPYPLLLHLRRSSPPRGAGFSLFRWRRG
GVWCVDPRTIRLPRGWRIRWIVLAARFVGGGELEVAPPAWF*

CDS

chr06:816230..816535 (- strand) : 306 bp

3'UTR

chr06:815874..816229 (- strand) : 356 bp

FASTA

>Os06t0114000-01 class=Sequence position=chr06:815874..816535 (- strand)
CCCCAAACCC CTCCTCACCC GCAGCGCCCC AACCCAACCC TCCCCGAGGT CGCAGCCTTA TCCTCTCCTC TCCCCTCCGC
GAGGTCAGGT GAGCTCAAAC CCTATCCCCT CCTCCTCCAC CTCCGCCGCT CCTCCCCGCC CCGGGGCGCT GGGTTCTCCC
TCTTCCGGTG GCGACGTGGT GGGGTGTGGT GTGTTGACCC CCGCACGATT CGGTTGCCGC GTGGTTGGAG GATTCGGTGG
ATAGTTCTCG CCGCGCGATT CGTGGGGGGC GGAGAGCTCG AGGTCGCGCC CCCCGCTTGG TTTTGAGGGG GGCCTTTTGA
TGGTTGCTCG TGCGGGCTAA TTTTGCGCTA GAACTGTTAT ATCAGTGGAA ATTGTTGGTT TAGTTAGCAC GGGGACTACA
GAATGTATCA GTGGAAATTG TTGGTTTAGT TAGCACGGGG ACTACAGAAT GTTGTTGGCT CCAGCGTTCT GTTCGTCTGG
TTGTGACTTT TGGCATGGGG TGTTCTAATT CAGCCAAGTA GAGTGGAGTA GGAGGGTGCA TGCGATATTC TGTTTGGCAG
TTGGAATGCT AGTGTTTTCA TGTATGCTAG TGATGGCCAG CCATTTGAAG CTGACGTAAC TGTTAGGGTG GTTGAATGGC
AAACATTTAA ATTTGAAGGT GT