Os06t0114000-02

Locus

Os06g0114000

Description

Similar to 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCPn60beta1, OsCPn60b1

Oryzabase Gene Name Synonym(s)

chaperonin 60 beta subunit 1

Transcript Evidence

AK101334 (DDBJ, Best hit)

Protein Evidence

XP_002894506.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: protein refolding (GO:0042026)

Biological Process: cellular protein metabolic process (GO:0044267)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Chaperonin Cpn60 (IPR001844)

Chaperonin Cpn60/TCP-1 (IPR002423)

Chaperonin Cpn60, conserved site (IPR018370)

Full-length cDNA

J033034I03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0114000-02)

RiceXPro (AK101334)

Others

Oryzabase (14350)

KEGG (Os06t0114000-02)

Transcript

2130 bp

>Os06t0114000-02 Similar to 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63).
CCCAAACCCCTCCTCACCCGCAGCGCCCCAACCCAACCCTCCCCGAGGTCGCAGCCTTAT
CCTCTCCTCTCCCCTCCGCGAGGAAATCATGGCTTCAACATTCGGTGCCACTTCTACGGT
TGGCCTCATGGCTGCGCCAACCGGAATTGTATCAGACAAGAAGCCATCTTCTCTATCTTC
GGTGTCATCTGTTTCTGTTGCCAGCCGACCACGCAATGCACGCCTTCAGAGGAAGTGCAA
CTTCAGGGTAAAAGCTGCCAAGGAGTTGTACTTCAACAAGGATGGCTCGGCTATCAAGAA
GCTTCAGACTGGAGTAAACAAGCTTGCTGACCTTGTTGGAGTTACACTGGGACCAAAGGG
AAGGAATGTTGTTTTGGAGAGCAAGTATGGGTCCCCTAGGATTGTCAATGATGGTGTTAC
AGTTGCAAGAGAGGTTGAACTGGAGGATCCTGTTGAAAATATTGGAGCTAAGTTGGTTAG
GCAAGCAGCAGCAAAGACCAATGATTTAGCTGGAGATGGCACAACTACTTCTGTTGTGCT
TGCTCAGGGGCTGATTGCTGAGGGTGTTAAGGTCGTTGCAGCTGGTGCCAATCCTGTGCA
AATTACACGTGGTATCGAGAAAACTGCGAAAGCACTAGTTGAAGAGCTAAAGAAATTGTC
AAAGGAGGTTGAAGACAGTGAGCTTGCGGATGTTGCTGCAGTCAGTGCTGGCAACAATTA
TGAAATCGGTAATATGATAGCAGAGGCTATGAGCAAGGTTGGCAGGAAGGGTGTGGTTAC
CCTTGAAGAAGGGAGAAGTTCTGAGAATAATCTCTATGTTGTGGAGGGAATGCAGTTTGA
ACGTGGTTATATCTCCCCGTATTTTGTAACTGACAGCGAGAAAATGTCTGCAGAATATGA
GAACTGCAAGCTTCTTTTGGTGGACAAAAAAATCACCAACGCAAGGGATCTTATCAATGT
TTTGGAGGAGGCCATAAGAGGTGCATACCCAATTCTGATAATTGCTGAGGATATTGAGCA
GGAGGCTCTTGCTACTCTTGTTGTCAACAAGCTTAGAGGGTCATTGAAAATTGCCGCTAT
CAAAGCCCCTGGTTTTGGTGAGCGCAAGACCCAGTACTTGGATGATATTGCCATTCTAAC
TGGAGCAACTGTAATCAGGGATGAAGTTGGGCTGTCACTTGACAAGGCAGACAAATCAGT
TTTAGGAACGGCTGCAAAGGTGGTCCTTAACAAAGAGTCAACAACAATTGTTGGTGATGG
CAGTACACAGGAAGAAGTGACTAAGAGGGTTGCACAAATAAAAAATCTCATCGAGGCTGC
CGAACAAGAATACGAGAAGGAAAAGCTCAATGAGAGGATTGCAAAGCTTGCTGGTGGTGT
TGCAGTCATTCAGGTGGGAGCACAAACAGAGACCGAACTAAAAGAGAAGAAGTTGAGAGT
TGAGGATGCCCTAAATGCTACCAAGGCTGCTGTTGAGGAAGGTATTGTTGTTGGTGGAGG
GTGCACTCTTCTGAGACTGGCAGCTAGAGTTGACGCCATCAAGGACAACCTGGAGAATGA
TGAGCAGAAGGTTGGAGCTGAAATTGTAAGGAGAGCGCTGAGCTACCCGCTTAAATTGAT
TGCTAAGAATGCTGGTGTTAATGGAAGCGTTGTTACCGAGAAGGTTCTCTCTAACGATAA
CTTCAAGTTTGGTTACAATGCTGCAACTGGACAGTACGAGGATTTGATGGCTGCTGGTAT
CATTGACCCCACTAAGGTGGTGAGATGTTGTCTTGAGCATGCTGCGTCGGTGGCCAAGAC
ATTCCTCACATCGGATGTCGTCGTCGTCGAGATCAAGGAGCCTGAGCCTGCGCCCGTCAC
CAACCCGATGGACAACTCCGGCTACGGGTACTGATGACTAAGTTACAGTTACTTGTTCTC
CGGGAAGGTCACTGGCCGTCAATTTTTGGGTAGTAGGCTTGAATCTGAATTTTGGTGAGA
TTTGAGTAGTTTCGAGACAATTTGATTTGTTCCCATGGGAAGTGAAATAAACAGGGTCAC
TATAGCAAAATTTGTGGTGTAACTGGAACGGCTGTCAAATTACGAAGGAAGATATTTGAA
AGATTTCATGCTCTCTGGGGTTTACCGTTG

CDS

1806 bp

>Os06t0114000-02 Similar to 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63).
ATGGCTTCAACATTCGGTGCCACTTCTACGGTTGGCCTCATGGCTGCGCCAACCGGAATT
GTATCAGACAAGAAGCCATCTTCTCTATCTTCGGTGTCATCTGTTTCTGTTGCCAGCCGA
CCACGCAATGCACGCCTTCAGAGGAAGTGCAACTTCAGGGTAAAAGCTGCCAAGGAGTTG
TACTTCAACAAGGATGGCTCGGCTATCAAGAAGCTTCAGACTGGAGTAAACAAGCTTGCT
GACCTTGTTGGAGTTACACTGGGACCAAAGGGAAGGAATGTTGTTTTGGAGAGCAAGTAT
GGGTCCCCTAGGATTGTCAATGATGGTGTTACAGTTGCAAGAGAGGTTGAACTGGAGGAT
CCTGTTGAAAATATTGGAGCTAAGTTGGTTAGGCAAGCAGCAGCAAAGACCAATGATTTA
GCTGGAGATGGCACAACTACTTCTGTTGTGCTTGCTCAGGGGCTGATTGCTGAGGGTGTT
AAGGTCGTTGCAGCTGGTGCCAATCCTGTGCAAATTACACGTGGTATCGAGAAAACTGCG
AAAGCACTAGTTGAAGAGCTAAAGAAATTGTCAAAGGAGGTTGAAGACAGTGAGCTTGCG
GATGTTGCTGCAGTCAGTGCTGGCAACAATTATGAAATCGGTAATATGATAGCAGAGGCT
ATGAGCAAGGTTGGCAGGAAGGGTGTGGTTACCCTTGAAGAAGGGAGAAGTTCTGAGAAT
AATCTCTATGTTGTGGAGGGAATGCAGTTTGAACGTGGTTATATCTCCCCGTATTTTGTA
ACTGACAGCGAGAAAATGTCTGCAGAATATGAGAACTGCAAGCTTCTTTTGGTGGACAAA
AAAATCACCAACGCAAGGGATCTTATCAATGTTTTGGAGGAGGCCATAAGAGGTGCATAC
CCAATTCTGATAATTGCTGAGGATATTGAGCAGGAGGCTCTTGCTACTCTTGTTGTCAAC
AAGCTTAGAGGGTCATTGAAAATTGCCGCTATCAAAGCCCCTGGTTTTGGTGAGCGCAAG
ACCCAGTACTTGGATGATATTGCCATTCTAACTGGAGCAACTGTAATCAGGGATGAAGTT
GGGCTGTCACTTGACAAGGCAGACAAATCAGTTTTAGGAACGGCTGCAAAGGTGGTCCTT
AACAAAGAGTCAACAACAATTGTTGGTGATGGCAGTACACAGGAAGAAGTGACTAAGAGG
GTTGCACAAATAAAAAATCTCATCGAGGCTGCCGAACAAGAATACGAGAAGGAAAAGCTC
AATGAGAGGATTGCAAAGCTTGCTGGTGGTGTTGCAGTCATTCAGGTGGGAGCACAAACA
GAGACCGAACTAAAAGAGAAGAAGTTGAGAGTTGAGGATGCCCTAAATGCTACCAAGGCT
GCTGTTGAGGAAGGTATTGTTGTTGGTGGAGGGTGCACTCTTCTGAGACTGGCAGCTAGA
GTTGACGCCATCAAGGACAACCTGGAGAATGATGAGCAGAAGGTTGGAGCTGAAATTGTA
AGGAGAGCGCTGAGCTACCCGCTTAAATTGATTGCTAAGAATGCTGGTGTTAATGGAAGC
GTTGTTACCGAGAAGGTTCTCTCTAACGATAACTTCAAGTTTGGTTACAATGCTGCAACT
GGACAGTACGAGGATTTGATGGCTGCTGGTATCATTGACCCCACTAAGGTGGTGAGATGT
TGTCTTGAGCATGCTGCGTCGGTGGCCAAGACATTCCTCACATCGGATGTCGTCGTCGTC
GAGATCAAGGAGCCTGAGCCTGCGCCCGTCACCAACCCGATGGACAACTCCGGCTACGGG
TACTGA

Protein

602 aa

>Os06t0114000-02 Similar to 60 kDa chaperonin (Protein Cpn60) (groEL protein) (63 kDa stress protein) (GSP63).
MASTFGATSTVGLMAAPTGIVSDKKPSSLSSVSSVSVASRPRNARLQRKCNFRVKAAKEL
YFNKDGSAIKKLQTGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELED
PVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVQITRGIEKTA
KALVEELKKLSKEVEDSELADVAAVSAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSEN
NLYVVEGMQFERGYISPYFVTDSEKMSAEYENCKLLLVDKKITNARDLINVLEEAIRGAY
PILIIAEDIEQEALATLVVNKLRGSLKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEV
GLSLDKADKSVLGTAAKVVLNKESTTIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKL
NERIAKLAGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAAR
VDAIKDNLENDEQKVGAEIVRRALSYPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAAT
GQYEDLMAAGIIDPTKVVRCCLEHAASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYG
Y*

5'UTR

chr06:816453..816534 (- strand) : 82 bp

chr06:815453..815458 (- strand) : 6 bp

CDS

chr06:815234..815452 (- strand) : 219 bp

chr06:815013..815138 (- strand) : 126 bp

chr06:814444..814581 (- strand) : 138 bp

chr06:814242..814337 (- strand) : 96 bp

chr06:813831..814073 (- strand) : 243 bp

chr06:813506..813740 (- strand) : 235 bp

chr06:813209..813378 (- strand) : 170 bp

chr06:812856..812933 (- strand) : 78 bp

chr06:812660..812731 (- strand) : 72 bp

chr06:812409..812513 (- strand) : 105 bp

chr06:812143..812235 (- strand) : 93 bp

chr06:811973..812065 (- strand) : 93 bp

chr06:811397..811520 (- strand) : 124 bp

chr06:811282..811295 (- strand) : 14 bp

3'UTR

chr06:811046..811281 (- strand) : 236 bp

FASTA

>Os06t0114000-02 class=Sequence position=chr06:811046..816534 (- strand)
CCCAAACCCC TCCTCACCCG CAGCGCCCCA ACCCAACCCT CCCCGAGGTC GCAGCCTTAT CCTCTCCTCT CCCCTCCGCG
AGGTCAGGTG AGCTCAAACC CTATCCCCTC CTCCTCCACC TCCGCCGCTC CTCCCCGCCC CGGGGCGCTG GGTTCTCCCT
CTTCCGGTGG CGACGTGGTG GGGTGTGGTG TGTTGACCCC CGCACGATTC GGTTGCCGCG TGGTTGGAGG ATTCGGTGGA
TAGTTCTCGC CGCGCGATTC GTGGGGGGCG GAGAGCTCGA GGTCGCGCCC CCCGCTTGGT TTTGAGGGGG GCCTTTTGAT
GGTTGCTCGT GCGGGCTAAT TTTGCGCTAG AACTGTTATA TCAGTGGAAA TTGTTGGTTT AGTTAGCACG GGGACTACAG
AATGTATCAG TGGAAATTGT TGGTTTAGTT AGCACGGGGA CTACAGAATG TTGTTGGCTC CAGCGTTCTG TTCGTCTGGT
TGTGACTTTT GGCATGGGGT GTTCTAATTC AGCCAAGTAG AGTGGAGTAG GAGGGTGCAT GCGATATTCT GTTTGGCAGT
TGGAATGCTA GTGTTTTCAT GTATGCTAGT GATGGCCAGC CATTTGAAGC TGACGTAACT GTTAGGGTGG TTGAATGGCA
AACATTTAAA TTTGAAGGTG TAGTTTCAAG TGCTAGAATG TATTGGTTGG CCATTCATGA TATTCGAGAA GGAATCCTGG
CAGCAGAGAT GCTTTAGTTG GTCTCTTTTT CGTTCAGTTT TAGCTATCTC ATACATATGC AGGTTATCAA CTCACTGTAA
TATACCCTGA AGTCCAGTTG TTAATTAATC TTCTACCTTG ACACTGTAAG AGATGTAGTC AATGATAATA TGTGGTAATA
TGCAGAGAGA GCACAAAACT ATGTTTAGCT TGGAAAATAC ATTTGCACAG AATGCACAAC AATTTTAAGC TCTTAGCTTT
GGTTGGCAAT ACATGAACTT TCATGTGGGA CCTCCACCTC AGCTTCCATT TTCTGAATAG AAGCTTAAGC ATGCTTATGA
TTGTTGCTCC ATGTTAATGT TGTCATTGCT GAACAGGAAA TCATGGCTTC AACATTCGGT GCCACTTCTA CGGTTGGCCT
CATGGCTGCG CCAACCGGAA TTGTATCAGA CAAGAAGCCA TCTTCTCTAT CTTCGGTGTC ATCTGTTTCT GTTGCCAGCC
GACCACGCAA TGCACGCCTT CAGAGGAAGT GCAACTTCAG GGTAAAAGCT GCCAAGGAGT TGTACTTCAA CAAGGATGGC
TCGGCTATCA AGAAGCTTCA GGTGAGCTCC AAAGTTCTTG GACACATCTT ATCAAATTTT GGTCACTATG ATTCTTAGCC
TTGACCAGGC ACTCATTAGT TATTTCTACA TGTCAGACTG GAGTAAACAA GCTTGCTGAC CTTGTTGGAG TTACACTGGG
ACCAAAGGGA AGGAATGTTG TTTTGGAGAG CAAGTATGGG TCCCCTAGGA TTGTCAATGA TGGTGTTACA GTTGCAAGAG
AGGTATATTA CAGTGTTTAT TGCGTCAAAT AGCATTGAAT TTCCTTACAA TTTGCTTGTT TGCTGTATGC TATACTTCCA
CAGAAAAAAA ATGTTTGTTT TGAAAAGTAA AACAGTCTGC ACATTTGCTC ACAAGTTTCA TGCGCAAGTG TATTTCTGTT
TACTATTGCT GGTTGCATTT TTGCACACCA TGTTCTATCA TAATTACCTT TGTGGGTTCT AATATATGAT CCTCTGACAA
GATGAACTAA AGTTTGATAG CTGGTCATTG ACTTAACTAT AGTGATTGTG CACCATTTGT TTTAGTCATG ATATAAAGAA
TTTTTCAATT TTATTTTCTT ATTGAACAAG TCAACTGGAG GTTTCTGGAT TATCTGTGTA ACCTAGTTCC AGAATTTGAG
CAGAATTTTC AAGTAACGAT CTCTGTACTG CAGGTTGAAC TGGAGGATCC TGTTGAAAAT ATTGGAGCTA AGTTGGTTAG
GCAAGCAGCA GCAAAGACCA ATGATTTAGC TGGAGATGGC ACAACTACTT CTGTTGTGCT TGCTCAGGGG CTGATTGCTG
AGGGTGTTAA GGTATGCTAT TAGTTGAGAC ATGAGACCTC TATTACTTGT ATGGTCAATC TGTTAAGAGT CGTTAATTTG
TGAACTAAGT GAAAATAATT CATTTGCTCT TTTTCAGGTC GTTGCAGCTG GTGCCAATCC TGTGCAAATT ACACGTGGTA
TCGAGAAAAC TGCGAAAGCA CTAGTTGAAG AGCTAAAGAA ATTGTCAAAG GAGGTAAAAT AATCGTCAGG CTCTAATGCT
TTCAGAATGT TTTAGTTGTG GTTGTGGCAA CCTGGTGTTT GTTGCAACAA TGCTTAGCTA GACTGAGTCA AATCAGATGA
TTTATCTATG TAGTATATGC TTTTTTTTGT TCTACTTATA AAAAACATTT TCTTGCTTTA GGTTGAAGAC AGTGAGCTTG
CGGATGTTGC TGCAGTCAGT GCTGGCAACA ATTATGAAAT CGGTAATATG ATAGCAGAGG CTATGAGCAA GGTTGGCAGG
AAGGGTGTGG TTACCCTTGA AGAAGGGAGA AGTTCTGAGA ATAATCTCTA TGTTGTGGAG GGAATGCAGT TTGAACGTGG
TTATATCTCC CCGTATTTTG TAACTGACAG CGAGAAAATG TCTGCAGAAT ATGAGAACTG CAAGGTAGCT TCAGCCTGAG
CACACATACC CCTGCTGTAT GCTGCTTTAA TCTGTTTCAG TTTCTTATTG CACTATGTTT CCACTATTTT TCAGCTTCTT
TTGGTGGACA AAAAAATCAC CAACGCAAGG GATCTTATCA ATGTTTTGGA GGAGGCCATA AGAGGTGCAT ACCCAATTCT
GATAATTGCT GAGGATATTG AGCAGGAGGC TCTTGCTACT CTTGTTGTCA ACAAGCTTAG AGGGTCATTG AAAATTGCCG
CTATCAAAGC CCCTGGTTTT GGTGAGCGCA AGACCCAGTA CTTGGATGAT ATTGCCATTC TAACTGGAGG TGAGGTGGAC
TTGCGATCTG GTGCATTTGG TTGGGTGATC ATTAATGCTG CTTATTTATG ATGATTCTGG AGCATCTGGC TGGATGATTA
ATGCTGCTTA TTTATAATGA TTTTTTTTCT CTGCAGCAAC TGTAATCAGG GATGAAGTTG GGCTGTCACT TGACAAGGCA
GACAAATCAG TTTTAGGAAC GGCTGCAAAG GTGGTCCTTA ACAAAGAGTC AACAACAATT GTTGGTGATG GCAGTACACA
GGAAGAAGTG ACTAAGAGGG TTGCACAAAT AAAAAATCTC ATCGAGGTAT GTTATATCTG TTTACCATGG TTAATTTGGC
ACAATAGTGC CTCGCAAATT TTTTTTTTTG GCACAATAGT GGTTCTATAT TCCACCATTT CTTTAATCTA GTTATAGACT
GTACATATCT GGAAATGTAG CTTGATTGGT TACATGCTTC ATCTGGTTTC AAACTGAAAG CTTTCTCTAT TATGAGGCTG
TATATTGAAT GTGTTGTTTG TACAAGAAAA GAAAAGCATC AGTCCTGCTC CTGATTGCTT TTTTATCTAT CCAATTTGCA
GGCTGCCGAA CAAGAATACG AGAAGGAAAA GCTCAATGAG AGGATTGCAA AGCTTGCTGG TGGTGTTGCA GTCATTCAGG
TATAATAAGA AATGGACAAA ATGCCATGTT ATCTGTATCT GTTCTTTTTC TTGGTTCTTT GTTTGGAAAG ATAGATAGAT
GTGGTTATGT GGGTCGTAAT CCAAGTTTTG TTACTTTTGA TAGGTGGGAG CACAAACAGA GACCGAACTA AAAGAGAAGA
AGTTGAGAGT TGAGGATGCC CTAAATGCTA CCAAGGTTAG TCTGTTGTTA TAACTGCTTT GAGATAGAAA TAGATTAATG
TTTGCTTCTT AAGGAAGAAA AATTAAGGTA GTTTGTTGCT CACTGAGTTG ATATCAACGT TCTTCTGGCT TTGGATCTTT
AAACCGCTTC CTCTTTGTCA GGCTGCTGTT GAGGAAGGTA TTGTTGTTGG TGGAGGGTGC ACTCTTCTGA GACTGGCAGC
TAGAGTTGAC GCCATCAAGG ACAACCTGGA GAATGATGAG CAGAAGGTTT ACAACCATGA TCTACTTTAT TCATTGTTTT
TGTTCGAGTG TTCTATAAAC CTCATCTCTC AAAAGTTCTG TTTTTGTGCC TGCTACTATG TATATGGGTT AGAAATGACC
ATCTCGAATT TGTTGTCCTT TCTAATTGAC TTGTTGTATG TATTGCTTGA ACTTTTTAGG TTGGAGCTGA AATTGTAAGG
AGAGCGCTGA GCTACCCGCT TAAATTGATT GCTAAGAATG CTGGTGTTAA TGGAAGCGTT GTTACCGAGA AGGTTAGATC
TTGTTCACTA ACAGAAAATC ATATGTTCAC ATGTACATCT GAATAACATA AAAGATGATG TTTTACCAGG TTCTCTCTAA
CGATAACTTC AAGTTTGGTT ACAATGCTGC AACTGGACAG TACGAGGATT TGATGGCTGC TGGTATCATT GACCCCACTA
AGGTCTGTTG CTCCCCATTG ATTTCCGATA TTTTTGCATA AAAATTTAGA TTGGTGGATT CCCTATATTT TAGCTGAAAT
AATTATAGCA GTGTGGACTG TGCAGTTACT TTTGTGTTCA CCCTTCAGTT CTTACACATA CAGCCATTGT TTTGTGTTGA
TGTTAGTAGT TTCTAATGAA GGTTCTAGAT CCAAGGCTTA GTGTTGTGGT CCTAGAAAGA TTGAATTGGA TGCACCATAC
AATTTGCTAG GTTTGATTTA GTTACTGCAA GAGAGTGAAA TTAACTTTGG GAAACGCTAA AGGAAAAGCA TGAACACAAG
TAAAAGAACA TAGAATTAGA CTGTAGCCCT TGCACATGGT TGACACACTA CGATTGTTGA TTCCCTTTTC CCTACCATGC
TTCATGAGAA CTGCGATGAG CTAAAGACTA TGCTTTCCTG ATGATGGGCA ACAGGTGGTG AGATGTTGTC TTGAGCATGC
TGCGTCGGTG GCCAAGACAT TCCTCACATC GGATGTCGTC GTCGTCGAGA TCAAGGAGCC TGAGCCTGCG CCCGTCACCA
ACCCGATGGA CAACTCCGGT AAATGATATT GGCCAAACGC ACTACACTTC AATTTCATGT GATCAAACAC TCCCTGAACT
GTTGCTAACT TTAAATCTGC TCCGTCTCTT TCTGTCCAGG CTACGGGTAC TGATGACTAA GTTACAGTTA CTTGTTCTCC
GGGAAGGTCA CTGGCCGTCA ATTTTTGGGT AGTAGGCTTG AATCTGAATT TTGGTGAGAT TTGAGTAGTT TCGAGACAAT
TTGATTTGTT CCCATGGGAA GTGAAATAAA CAGGGTCACT ATAGCAAAAT TTGTGGTGTA ACTGGAACGG CTGTCAAATT
ACGAAGGAAG ATATTTGAAA GATTTCATGC TCTCTGGGGT TTACCGTTG