Os06t0114000-03

Locus

Os06g0114000

Description

Similar to RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCPn60beta1, OsCPn60b1

Oryzabase Gene Name Synonym(s)

chaperonin 60 beta subunit 1

Transcript Evidence

AK062098 (DDBJ, Best hit)

Protein Evidence

Q43831 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: protein refolding (GO:0042026)

Biological Process: cellular protein metabolic process (GO:0044267)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Chaperonin Cpn60 (IPR001844)

Chaperonin Cpn60/TCP-1 (IPR002423)

Chaperonin Cpn60, conserved site (IPR018370)

Full-length cDNA

001-045-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0114000-03)

RiceXPro (AK062098)

Others

Oryzabase (14350)

KEGG (Os06t0114000-03)

Transcript

1781 bp

>Os06t0114000-03 Similar to RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment).
CTTGTTGGAGTTACACTGGGACCAAAGGGAAGGAATGTTGTTTTGGAGAGCAAGTATGGG
TCCCCTAGGATTGTCAATGATGGTGTTACAGTTGCAAGAGAGGTTGAACTGGAGGATCCT
GTTGAAAATATTGGAGCTAAGTTGGTTAGGCAAGCAGCAGCAAAGACCAATGATTTAGCT
GGAGATGGCACAACTACTTCTGTTGTGCTTGCTCAGGGGCTGATTGCTGAGGGTGTTAAG
GTCGTTGCAGCTGGTGCCAATCCTGTGCAAATTACACGTGGTATCGAGAAAACTGCGAAA
GCACTAGTTGAAGAGCTAAAGAAATTGTCAAAGGAGGTTGAAGACAGTGAGCTTGCGGAT
GTTGCTGCAGTCAGTGCTGGCAACAATTATGAAATCGGTAATATGATAGCAGAGGCTATG
AGCAAGGTTGGCAGGAAGGGTGTGGTTACCCTTGAAGAAGGGAGAAGTTCTGAGAATAAT
CTCTATGTTGTGGAGGGAATGCAGTTTGAACGTGGTTATATCTCCCCGTATTTTGTAACT
GACAGCGAGAAAATGTCTGCAGAATATGAGAACTGCAAGCTTCTTTTGGTGGACAAAAAA
ATCACCAACGCAAGGGATCTTATCAATGTTTTGGAGGAGGCCATAAGAGGTGCATACCCA
ATTCTGATAATTGCTGAGGATATTGAGCAGGAGGCTCTTGCTACTCTTGTTGTCAACAAG
CTTAGAGGGTCATTGAAAATTGCCGCTATCAAAGCCCCTGGTTTTGGTGAGCGCAAGACC
CAGTACTTGGATGATATTGCCATTCTAACTGGAGCAACTGTAATCAGGGATGAAGTTGGG
CTGTCACTTGACAAGGCAGACAAATCAGTTTTAGGAACGGCTGCAAAGGTGGTCCTTAAC
AAAGAGTCAACAACAATTGTTGGTGATGGCAGTACACAGGAAGAAGTGACTAAGAGGGTT
GCACAAATAAAAAATCTCATCGAGGCTGCCGAACAAGAATACGAGAAGGAAAAGCTCAAT
GAGAGGATTGCAAAGCTTGCTGGTGGTGTTGCAGTCATTCAGGTGGGAGCACAAACAGAG
ACCGAACTAAAAGAGAAGAAGTTGAGAGTTGAGGATGCCCTAAATGCTACCAAGGCTGCT
GTTGAGGAAGGTATTGTTGTTGGTGGAGGGTGCACTCTTCTGAGACTGGCAGCTAGAGTT
GACGCCATCAAGGACAACCTGGAGAATGATGAGCAGAAGGTTGGAGCTGAAATTGTAAGG
AGAGCGCTGAGCTACCCGCTTAAATTGATTGCTAAGAATGCTGGTGTTAATGGAAGCGTT
GTTACCGAGAAGGTTCTCTCTAACGATAACTTCAAGTTTGGTTACAATGCTGCAACTGGA
CAGTACGAGGATTTGATGGCTGCTGGTATCATTGACCCCACTAAGGTGGTGAGATGTTGT
CTTGAGCATGCTGCGTCGGTGGCCAAGACATTCCTCACATCGGATGTCGTCGTCGTCGAG
ATCAAGGAGCCTGAGCCTGCGCCCGTCACCAACCCGATGGACAACTCCGGCTACGGGTAC
TGATGACTAAGTTACAGTTACTTGTTCTCCGGGAAGGTCACTGGCCGTCAATTTTTGGGT
AGTAGGCTTGAATCTGAATTTTGGTGAGATTTGAGTAGTTTCGAGACAATTTGATTTGTT
CCCATGGGAAGTGAAATAAACAGGGTCACTATAGCAAAATTTGTGGTGTAACTGGAACGG
CTGTCAAATTACGAAGGAAGATATTTGAAAGATTTCATGCT

CDS

1563 bp

>Os06t0114000-03 Similar to RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment).
CTTGTTGGAGTTACACTGGGACCAAAGGGAAGGAATGTTGTTTTGGAGAGCAAGTATGGG
TCCCCTAGGATTGTCAATGATGGTGTTACAGTTGCAAGAGAGGTTGAACTGGAGGATCCT
GTTGAAAATATTGGAGCTAAGTTGGTTAGGCAAGCAGCAGCAAAGACCAATGATTTAGCT
GGAGATGGCACAACTACTTCTGTTGTGCTTGCTCAGGGGCTGATTGCTGAGGGTGTTAAG
GTCGTTGCAGCTGGTGCCAATCCTGTGCAAATTACACGTGGTATCGAGAAAACTGCGAAA
GCACTAGTTGAAGAGCTAAAGAAATTGTCAAAGGAGGTTGAAGACAGTGAGCTTGCGGAT
GTTGCTGCAGTCAGTGCTGGCAACAATTATGAAATCGGTAATATGATAGCAGAGGCTATG
AGCAAGGTTGGCAGGAAGGGTGTGGTTACCCTTGAAGAAGGGAGAAGTTCTGAGAATAAT
CTCTATGTTGTGGAGGGAATGCAGTTTGAACGTGGTTATATCTCCCCGTATTTTGTAACT
GACAGCGAGAAAATGTCTGCAGAATATGAGAACTGCAAGCTTCTTTTGGTGGACAAAAAA
ATCACCAACGCAAGGGATCTTATCAATGTTTTGGAGGAGGCCATAAGAGGTGCATACCCA
ATTCTGATAATTGCTGAGGATATTGAGCAGGAGGCTCTTGCTACTCTTGTTGTCAACAAG
CTTAGAGGGTCATTGAAAATTGCCGCTATCAAAGCCCCTGGTTTTGGTGAGCGCAAGACC
CAGTACTTGGATGATATTGCCATTCTAACTGGAGCAACTGTAATCAGGGATGAAGTTGGG
CTGTCACTTGACAAGGCAGACAAATCAGTTTTAGGAACGGCTGCAAAGGTGGTCCTTAAC
AAAGAGTCAACAACAATTGTTGGTGATGGCAGTACACAGGAAGAAGTGACTAAGAGGGTT
GCACAAATAAAAAATCTCATCGAGGCTGCCGAACAAGAATACGAGAAGGAAAAGCTCAAT
GAGAGGATTGCAAAGCTTGCTGGTGGTGTTGCAGTCATTCAGGTGGGAGCACAAACAGAG
ACCGAACTAAAAGAGAAGAAGTTGAGAGTTGAGGATGCCCTAAATGCTACCAAGGCTGCT
GTTGAGGAAGGTATTGTTGTTGGTGGAGGGTGCACTCTTCTGAGACTGGCAGCTAGAGTT
GACGCCATCAAGGACAACCTGGAGAATGATGAGCAGAAGGTTGGAGCTGAAATTGTAAGG
AGAGCGCTGAGCTACCCGCTTAAATTGATTGCTAAGAATGCTGGTGTTAATGGAAGCGTT
GTTACCGAGAAGGTTCTCTCTAACGATAACTTCAAGTTTGGTTACAATGCTGCAACTGGA
CAGTACGAGGATTTGATGGCTGCTGGTATCATTGACCCCACTAAGGTGGTGAGATGTTGT
CTTGAGCATGCTGCGTCGGTGGCCAAGACATTCCTCACATCGGATGTCGTCGTCGTCGAG
ATCAAGGAGCCTGAGCCTGCGCCCGTCACCAACCCGATGGACAACTCCGGCTACGGGTAC
TGA

Protein

521 aa

>Os06t0114000-03 Similar to RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment).
LVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLA
GDGTTTSVVLAQGLIAEGVKVVAAGANPVQITRGIEKTAKALVEELKKLSKEVEDSELAD
VAAVSAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVT
DSEKMSAEYENCKLLLVDKKITNARDLINVLEEAIRGAYPILIIAEDIEQEALATLVVNK
LRGSLKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDKADKSVLGTAAKVVLN
KESTTIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAKLAGGVAVIQVGAQTE
TELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAARVDAIKDNLENDEQKVGAEIVR
RALSYPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDLMAAGIIDPTKVVRCC
LEHAASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYGY*

CDS

chr06:815013..815114 (- strand) : 102 bp

chr06:814444..814581 (- strand) : 138 bp

chr06:814242..814337 (- strand) : 96 bp

chr06:813831..814073 (- strand) : 243 bp

chr06:813506..813740 (- strand) : 235 bp

chr06:813209..813378 (- strand) : 170 bp

chr06:812856..812933 (- strand) : 78 bp

chr06:812660..812731 (- strand) : 72 bp

chr06:812409..812513 (- strand) : 105 bp

chr06:812143..812235 (- strand) : 93 bp

chr06:811973..812065 (- strand) : 93 bp

chr06:811397..811520 (- strand) : 124 bp

chr06:811282..811295 (- strand) : 14 bp

3'UTR

chr06:811064..811281 (- strand) : 218 bp

FASTA

>Os06t0114000-03 class=Sequence position=chr06:811064..815114 (- strand)
CTTGTTGGAG TTACACTGGG ACCAAAGGGA AGGAATGTTG TTTTGGAGAG CAAGTATGGG TCCCCTAGGA TTGTCAATGA
TGGTGTTACA GTTGCAAGAG AGGTATATTA CAGTGTTTAT TGCGTCAAAT AGCATTGAAT TTCCTTACAA TTTGCTTGTT
TGCTGTATGC TATACTTCCA CAGAAAAAAA ATGTTTGTTT TGAAAAGTAA AACAGTCTGC ACATTTGCTC ACAAGTTTCA
TGCGCAAGTG TATTTCTGTT TACTATTGCT GGTTGCATTT TTGCACACCA TGTTCTATCA TAATTACCTT TGTGGGTTCT
AATATATGAT CCTCTGACAA GATGAACTAA AGTTTGATAG CTGGTCATTG ACTTAACTAT AGTGATTGTG CACCATTTGT
TTTAGTCATG ATATAAAGAA TTTTTCAATT TTATTTTCTT ATTGAACAAG TCAACTGGAG GTTTCTGGAT TATCTGTGTA
ACCTAGTTCC AGAATTTGAG CAGAATTTTC AAGTAACGAT CTCTGTACTG CAGGTTGAAC TGGAGGATCC TGTTGAAAAT
ATTGGAGCTA AGTTGGTTAG GCAAGCAGCA GCAAAGACCA ATGATTTAGC TGGAGATGGC ACAACTACTT CTGTTGTGCT
TGCTCAGGGG CTGATTGCTG AGGGTGTTAA GGTATGCTAT TAGTTGAGAC ATGAGACCTC TATTACTTGT ATGGTCAATC
TGTTAAGAGT CGTTAATTTG TGAACTAAGT GAAAATAATT CATTTGCTCT TTTTCAGGTC GTTGCAGCTG GTGCCAATCC
TGTGCAAATT ACACGTGGTA TCGAGAAAAC TGCGAAAGCA CTAGTTGAAG AGCTAAAGAA ATTGTCAAAG GAGGTAAAAT
AATCGTCAGG CTCTAATGCT TTCAGAATGT TTTAGTTGTG GTTGTGGCAA CCTGGTGTTT GTTGCAACAA TGCTTAGCTA
GACTGAGTCA AATCAGATGA TTTATCTATG TAGTATATGC TTTTTTTTGT TCTACTTATA AAAAACATTT TCTTGCTTTA
GGTTGAAGAC AGTGAGCTTG CGGATGTTGC TGCAGTCAGT GCTGGCAACA ATTATGAAAT CGGTAATATG ATAGCAGAGG
CTATGAGCAA GGTTGGCAGG AAGGGTGTGG TTACCCTTGA AGAAGGGAGA AGTTCTGAGA ATAATCTCTA TGTTGTGGAG
GGAATGCAGT TTGAACGTGG TTATATCTCC CCGTATTTTG TAACTGACAG CGAGAAAATG TCTGCAGAAT ATGAGAACTG
CAAGGTAGCT TCAGCCTGAG CACACATACC CCTGCTGTAT GCTGCTTTAA TCTGTTTCAG TTTCTTATTG CACTATGTTT
CCACTATTTT TCAGCTTCTT TTGGTGGACA AAAAAATCAC CAACGCAAGG GATCTTATCA ATGTTTTGGA GGAGGCCATA
AGAGGTGCAT ACCCAATTCT GATAATTGCT GAGGATATTG AGCAGGAGGC TCTTGCTACT CTTGTTGTCA ACAAGCTTAG
AGGGTCATTG AAAATTGCCG CTATCAAAGC CCCTGGTTTT GGTGAGCGCA AGACCCAGTA CTTGGATGAT ATTGCCATTC
TAACTGGAGG TGAGGTGGAC TTGCGATCTG GTGCATTTGG TTGGGTGATC ATTAATGCTG CTTATTTATG ATGATTCTGG
AGCATCTGGC TGGATGATTA ATGCTGCTTA TTTATAATGA TTTTTTTTCT CTGCAGCAAC TGTAATCAGG GATGAAGTTG
GGCTGTCACT TGACAAGGCA GACAAATCAG TTTTAGGAAC GGCTGCAAAG GTGGTCCTTA ACAAAGAGTC AACAACAATT
GTTGGTGATG GCAGTACACA GGAAGAAGTG ACTAAGAGGG TTGCACAAAT AAAAAATCTC ATCGAGGTAT GTTATATCTG
TTTACCATGG TTAATTTGGC ACAATAGTGC CTCGCAAATT TTTTTTTTTG GCACAATAGT GGTTCTATAT TCCACCATTT
CTTTAATCTA GTTATAGACT GTACATATCT GGAAATGTAG CTTGATTGGT TACATGCTTC ATCTGGTTTC AAACTGAAAG
CTTTCTCTAT TATGAGGCTG TATATTGAAT GTGTTGTTTG TACAAGAAAA GAAAAGCATC AGTCCTGCTC CTGATTGCTT
TTTTATCTAT CCAATTTGCA GGCTGCCGAA CAAGAATACG AGAAGGAAAA GCTCAATGAG AGGATTGCAA AGCTTGCTGG
TGGTGTTGCA GTCATTCAGG TATAATAAGA AATGGACAAA ATGCCATGTT ATCTGTATCT GTTCTTTTTC TTGGTTCTTT
GTTTGGAAAG ATAGATAGAT GTGGTTATGT GGGTCGTAAT CCAAGTTTTG TTACTTTTGA TAGGTGGGAG CACAAACAGA
GACCGAACTA AAAGAGAAGA AGTTGAGAGT TGAGGATGCC CTAAATGCTA CCAAGGTTAG TCTGTTGTTA TAACTGCTTT
GAGATAGAAA TAGATTAATG TTTGCTTCTT AAGGAAGAAA AATTAAGGTA GTTTGTTGCT CACTGAGTTG ATATCAACGT
TCTTCTGGCT TTGGATCTTT AAACCGCTTC CTCTTTGTCA GGCTGCTGTT GAGGAAGGTA TTGTTGTTGG TGGAGGGTGC
ACTCTTCTGA GACTGGCAGC TAGAGTTGAC GCCATCAAGG ACAACCTGGA GAATGATGAG CAGAAGGTTT ACAACCATGA
TCTACTTTAT TCATTGTTTT TGTTCGAGTG TTCTATAAAC CTCATCTCTC AAAAGTTCTG TTTTTGTGCC TGCTACTATG
TATATGGGTT AGAAATGACC ATCTCGAATT TGTTGTCCTT TCTAATTGAC TTGTTGTATG TATTGCTTGA ACTTTTTAGG
TTGGAGCTGA AATTGTAAGG AGAGCGCTGA GCTACCCGCT TAAATTGATT GCTAAGAATG CTGGTGTTAA TGGAAGCGTT
GTTACCGAGA AGGTTAGATC TTGTTCACTA ACAGAAAATC ATATGTTCAC ATGTACATCT GAATAACATA AAAGATGATG
TTTTACCAGG TTCTCTCTAA CGATAACTTC AAGTTTGGTT ACAATGCTGC AACTGGACAG TACGAGGATT TGATGGCTGC
TGGTATCATT GACCCCACTA AGGTCTGTTG CTCCCCATTG ATTTCCGATA TTTTTGCATA AAAATTTAGA TTGGTGGATT
CCCTATATTT TAGCTGAAAT AATTATAGCA GTGTGGACTG TGCAGTTACT TTTGTGTTCA CCCTTCAGTT CTTACACATA
CAGCCATTGT TTTGTGTTGA TGTTAGTAGT TTCTAATGAA GGTTCTAGAT CCAAGGCTTA GTGTTGTGGT CCTAGAAAGA
TTGAATTGGA TGCACCATAC AATTTGCTAG GTTTGATTTA GTTACTGCAA GAGAGTGAAA TTAACTTTGG GAAACGCTAA
AGGAAAAGCA TGAACACAAG TAAAAGAACA TAGAATTAGA CTGTAGCCCT TGCACATGGT TGACACACTA CGATTGTTGA
TTCCCTTTTC CCTACCATGC TTCATGAGAA CTGCGATGAG CTAAAGACTA TGCTTTCCTG ATGATGGGCA ACAGGTGGTG
AGATGTTGTC TTGAGCATGC TGCGTCGGTG GCCAAGACAT TCCTCACATC GGATGTCGTC GTCGTCGAGA TCAAGGAGCC
TGAGCCTGCG CCCGTCACCA ACCCGATGGA CAACTCCGGT AAATGATATT GGCCAAACGC ACTACACTTC AATTTCATGT
GATCAAACAC TCCCTGAACT GTTGCTAACT TTAAATCTGC TCCGTCTCTT TCTGTCCAGG CTACGGGTAC TGATGACTAA
GTTACAGTTA CTTGTTCTCC GGGAAGGTCA CTGGCCGTCA ATTTTTGGGT AGTAGGCTTG AATCTGAATT TTGGTGAGAT
TTGAGTAGTT TCGAGACAAT TTGATTTGTT CCCATGGGAA GTGAAATAAA CAGGGTCACT ATAGCAAAAT TTGTGGTGTA
ACTGGAACGG CTGTCAAATT ACGAAGGAAG ATATTTGAAA GATTTCATGC T