Os06t0114000-04

Locus

Os06g0114000

Description

Similar to RuBisCo subunit binding-protein beta subunit (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCPn60beta1, OsCPn60b1

Oryzabase Gene Name Synonym(s)

chaperonin 60 beta subunit 1

Transcript Evidence

AK060117 (DDBJ, Best hit)

Protein Evidence

Q6B7Q9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: protein refolding (GO:0042026)

Biological Process: cellular protein metabolic process (GO:0044267)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Chaperonin Cpn60 (IPR001844)

Chaperonin Cpn60/TCP-1 (IPR002423)

Chaperonin Cpn60, conserved site (IPR018370)

Full-length cDNA

006-308-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0114000-04)

RiceXPro (AK060117)

Others

Oryzabase (14350)

KEGG (Os06t0114000-04)

Transcript

1097 bp

>Os06t0114000-04 Similar to RuBisCo subunit binding-protein beta subunit (Fragment).
TGAGGATATTGAGCAGGAGGCTCTTGCTACTCTTGTTGTCAACAAGCTTAGAGGGTCATT
GAAAATTGCCGCTATCAAAGCCCCTGGTTTTGGTGAGCGCAAGACCCAGTACTTGGATGA
TATTGCCATTCTAACTGGAGCAACTGTAATCAGGGATGAAGTTGGGCTGTCACTTGACAA
GGCAGACAAATCAGTTTTAGGAACGGCTGCAAAGGTGGTCCTTAACAAAGAGTCAACAAC
AATTGTTGGTGATGGCAGTACACAGGAAGAAGTGACTAAGAGGGTTGCACAAATAAAAAA
TCTCATCGAGGCTGCCGAACAAGAATACGAGAAGGAAAAGCTCAATGAGAGGATTGCAAA
GCTTGCTGGTGGTGTTGCAGTCATTCAGGTGGGAGCACAAACAGAGACCGAACTAAAAGA
GAAGAAGTTGAGAGTTGAGGATGCCCTAAATGCTACCAAGGCTGCTGTTGAGGAAGGTAT
TGTTGTTGGTGGAGGGTGCACTCTTCTGAGACTGGCAGCTAGAGTTGACGCCATCAAGGA
CAACCTGGAGAATGATGAGCAGAAGGTTGGAGCTGAAATTGTAAGGAGAGCGCTGAGCTA
CCCGCTTAAATTGATTGCTAAGAATGCTGGTGTTAATGGAAGCGTTGTTACCGAGAAGGT
TCTCTCTAACGATAACTTCAAGTTTGGTTACAATGCTGCAACTGGACAGTACGAGGATTT
GATGGCTGCTGGTATCATTGACCCCACTAAGGTGGTGAGATGTTGTCTTGAGCATGCTGC
GTCGGTGGCCAAGACATTCCTCACATCGGATGTCGTCGTCGTCGAGATCAAGGAGCCTGA
GCCTGCGCCCGTCACCAACCCGATGGACAACTCCGGCTACGGGTACTGATGACTAAGTTA
CAGTTACTTGTTCTCCGGGAAGGTCACTGGCCGTCAATTTTTGGGTAGTAGGCTTGAATC
TGAATTTTGGTGAGATTTGAGTAGTTTCGAGACAATTTGATTTGTTCCCATGGGAAGTGA
AATAAACAGGGTCACTATAGCAAAATTTGTGGTGTAACTGGAACGGCTGTCAAATTACGA
AGGAAGATATTTGAAAG

CDS

888 bp

>Os06t0114000-04 Similar to RuBisCo subunit binding-protein beta subunit (Fragment).
GAGGATATTGAGCAGGAGGCTCTTGCTACTCTTGTTGTCAACAAGCTTAGAGGGTCATTG
AAAATTGCCGCTATCAAAGCCCCTGGTTTTGGTGAGCGCAAGACCCAGTACTTGGATGAT
ATTGCCATTCTAACTGGAGCAACTGTAATCAGGGATGAAGTTGGGCTGTCACTTGACAAG
GCAGACAAATCAGTTTTAGGAACGGCTGCAAAGGTGGTCCTTAACAAAGAGTCAACAACA
ATTGTTGGTGATGGCAGTACACAGGAAGAAGTGACTAAGAGGGTTGCACAAATAAAAAAT
CTCATCGAGGCTGCCGAACAAGAATACGAGAAGGAAAAGCTCAATGAGAGGATTGCAAAG
CTTGCTGGTGGTGTTGCAGTCATTCAGGTGGGAGCACAAACAGAGACCGAACTAAAAGAG
AAGAAGTTGAGAGTTGAGGATGCCCTAAATGCTACCAAGGCTGCTGTTGAGGAAGGTATT
GTTGTTGGTGGAGGGTGCACTCTTCTGAGACTGGCAGCTAGAGTTGACGCCATCAAGGAC
AACCTGGAGAATGATGAGCAGAAGGTTGGAGCTGAAATTGTAAGGAGAGCGCTGAGCTAC
CCGCTTAAATTGATTGCTAAGAATGCTGGTGTTAATGGAAGCGTTGTTACCGAGAAGGTT
CTCTCTAACGATAACTTCAAGTTTGGTTACAATGCTGCAACTGGACAGTACGAGGATTTG
ATGGCTGCTGGTATCATTGACCCCACTAAGGTGGTGAGATGTTGTCTTGAGCATGCTGCG
TCGGTGGCCAAGACATTCCTCACATCGGATGTCGTCGTCGTCGAGATCAAGGAGCCTGAG
CCTGCGCCCGTCACCAACCCGATGGACAACTCCGGCTACGGGTACTGA

Protein

296 aa

>Os06t0114000-04 Similar to RuBisCo subunit binding-protein beta subunit (Fragment).
EDIEQEALATLVVNKLRGSLKIAAIKAPGFGERKTQYLDDIAILTGATVIRDEVGLSLDK
ADKSVLGTAAKVVLNKESTTIVGDGSTQEEVTKRVAQIKNLIEAAEQEYEKEKLNERIAK
LAGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLAARVDAIKD
NLENDEQKVGAEIVRRALSYPLKLIAKNAGVNGSVVTEKVLSNDNFKFGYNAATGQYEDL
MAAGIIDPTKVVRCCLEHAASVAKTFLTSDVVVVEIKEPEPAPVTNPMDNSGYGY*

5'UTR

chr06:813645..813645 (- strand) : 1 bp

CDS

chr06:813506..813644 (- strand) : 139 bp

chr06:813209..813378 (- strand) : 170 bp

chr06:812856..812933 (- strand) : 78 bp

chr06:812660..812731 (- strand) : 72 bp

chr06:812409..812513 (- strand) : 105 bp

chr06:812143..812235 (- strand) : 93 bp

chr06:811973..812065 (- strand) : 93 bp

chr06:811397..811520 (- strand) : 124 bp

chr06:811282..811295 (- strand) : 14 bp

3'UTR

chr06:811074..811281 (- strand) : 208 bp

FASTA

>Os06t0114000-04 class=Sequence position=chr06:811074..813645 (- strand)
TGAGGATATT GAGCAGGAGG CTCTTGCTAC TCTTGTTGTC AACAAGCTTA GAGGGTCATT GAAAATTGCC GCTATCAAAG
CCCCTGGTTT TGGTGAGCGC AAGACCCAGT ACTTGGATGA TATTGCCATT CTAACTGGAG GTGAGGTGGA CTTGCGATCT
GGTGCATTTG GTTGGGTGAT CATTAATGCT GCTTATTTAT GATGATTCTG GAGCATCTGG CTGGATGATT AATGCTGCTT
ATTTATAATG ATTTTTTTTC TCTGCAGCAA CTGTAATCAG GGATGAAGTT GGGCTGTCAC TTGACAAGGC AGACAAATCA
GTTTTAGGAA CGGCTGCAAA GGTGGTCCTT AACAAAGAGT CAACAACAAT TGTTGGTGAT GGCAGTACAC AGGAAGAAGT
GACTAAGAGG GTTGCACAAA TAAAAAATCT CATCGAGGTA TGTTATATCT GTTTACCATG GTTAATTTGG CACAATAGTG
CCTCGCAAAT TTTTTTTTTT GGCACAATAG TGGTTCTATA TTCCACCATT TCTTTAATCT AGTTATAGAC TGTACATATC
TGGAAATGTA GCTTGATTGG TTACATGCTT CATCTGGTTT CAAACTGAAA GCTTTCTCTA TTATGAGGCT GTATATTGAA
TGTGTTGTTT GTACAAGAAA AGAAAAGCAT CAGTCCTGCT CCTGATTGCT TTTTTATCTA TCCAATTTGC AGGCTGCCGA
ACAAGAATAC GAGAAGGAAA AGCTCAATGA GAGGATTGCA AAGCTTGCTG GTGGTGTTGC AGTCATTCAG GTATAATAAG
AAATGGACAA AATGCCATGT TATCTGTATC TGTTCTTTTT CTTGGTTCTT TGTTTGGAAA GATAGATAGA TGTGGTTATG
TGGGTCGTAA TCCAAGTTTT GTTACTTTTG ATAGGTGGGA GCACAAACAG AGACCGAACT AAAAGAGAAG AAGTTGAGAG
TTGAGGATGC CCTAAATGCT ACCAAGGTTA GTCTGTTGTT ATAACTGCTT TGAGATAGAA ATAGATTAAT GTTTGCTTCT
TAAGGAAGAA AAATTAAGGT AGTTTGTTGC TCACTGAGTT GATATCAACG TTCTTCTGGC TTTGGATCTT TAAACCGCTT
CCTCTTTGTC AGGCTGCTGT TGAGGAAGGT ATTGTTGTTG GTGGAGGGTG CACTCTTCTG AGACTGGCAG CTAGAGTTGA
CGCCATCAAG GACAACCTGG AGAATGATGA GCAGAAGGTT TACAACCATG ATCTACTTTA TTCATTGTTT TTGTTCGAGT
GTTCTATAAA CCTCATCTCT CAAAAGTTCT GTTTTTGTGC CTGCTACTAT GTATATGGGT TAGAAATGAC CATCTCGAAT
TTGTTGTCCT TTCTAATTGA CTTGTTGTAT GTATTGCTTG AACTTTTTAG GTTGGAGCTG AAATTGTAAG GAGAGCGCTG
AGCTACCCGC TTAAATTGAT TGCTAAGAAT GCTGGTGTTA ATGGAAGCGT TGTTACCGAG AAGGTTAGAT CTTGTTCACT
AACAGAAAAT CATATGTTCA CATGTACATC TGAATAACAT AAAAGATGAT GTTTTACCAG GTTCTCTCTA ACGATAACTT
CAAGTTTGGT TACAATGCTG CAACTGGACA GTACGAGGAT TTGATGGCTG CTGGTATCAT TGACCCCACT AAGGTCTGTT
GCTCCCCATT GATTTCCGAT ATTTTTGCAT AAAAATTTAG ATTGGTGGAT TCCCTATATT TTAGCTGAAA TAATTATAGC
AGTGTGGACT GTGCAGTTAC TTTTGTGTTC ACCCTTCAGT TCTTACACAT ACAGCCATTG TTTTGTGTTG ATGTTAGTAG
TTTCTAATGA AGGTTCTAGA TCCAAGGCTT AGTGTTGTGG TCCTAGAAAG ATTGAATTGG ATGCACCATA CAATTTGCTA
GGTTTGATTT AGTTACTGCA AGAGAGTGAA ATTAACTTTG GGAAACGCTA AAGGAAAAGC ATGAACACAA GTAAAAGAAC
ATAGAATTAG ACTGTAGCCC TTGCACATGG TTGACACACT ACGATTGTTG ATTCCCTTTT CCCTACCATG CTTCATGAGA
ACTGCGATGA GCTAAAGACT ATGCTTTCCT GATGATGGGC AACAGGTGGT GAGATGTTGT CTTGAGCATG CTGCGTCGGT
GGCCAAGACA TTCCTCACAT CGGATGTCGT CGTCGTCGAG ATCAAGGAGC CTGAGCCTGC GCCCGTCACC AACCCGATGG
ACAACTCCGG TAAATGATAT TGGCCAAACG CACTACACTT CAATTTCATG TGATCAAACA CTCCCTGAAC TGTTGCTAAC
TTTAAATCTG CTCCGTCTCT TTCTGTCCAG GCTACGGGTA CTGATGACTA AGTTACAGTT ACTTGTTCTC CGGGAAGGTC
ACTGGCCGTC AATTTTTGGG TAGTAGGCTT GAATCTGAAT TTTGGTGAGA TTTGAGTAGT TTCGAGACAA TTTGATTTGT
TCCCATGGGA AGTGAAATAA ACAGGGTCAC TATAGCAAAA TTTGTGGTGT AACTGGAACG GCTGTCAAAT TACGAAGGAA
GATATTTGAA AG