Os06t0114200-00

Locus

Os06g0114200

Description

Similar to ATARFB1B; GTP binding.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ARFB1A

CGSNL Gene Name

ADP-RIBOSYLATION FACTOR B1A

Oryzabase Gene Symbol Synonym(s)

OsARFB1a, ARFB1a

Oryzabase Gene Name Synonym(s)

ADP-ribosylation factor B1a

Transcript Evidence

ab initio prediction

Protein Evidence

NP_197208.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, SAR1-type (IPR006687)

Small GTPase superfamily, ARF/SAR type (IPR006689)

Small GTPase superfamily, ARF type (IPR024156)

Expression Databases

TENOR (Os06t0114200-00)

Others

Oryzabase (21007)

Transcript

570 bp

>Os06t0114200-00 Similar to ATARFB1B; GTP binding.
ATGGGGCAGTCCCTGAGGAAGCTGTTCGACAGCTTCTGCACAAAGGAGATGAAGGTTCTG
ATGCTTGGGCTGGATGCTGCTGGGAAGACGACGATTCTGTACAGGCTGCACATTGGCGAA
GTTCTGTCCTCCATACCCACAATCGGGTTCAACGTGGAGAAGGTGGAGTACAAGAACGTG
GCCTTCACGGTGTGGGACGTGGGAGGCCAGGACAAGCTCCGACCTCTCTGGAGACAATAC
TTCAGAAACGCCGACGCCCTGATCTACGTGGTTGATTCGATGGACAGGGAAAGGATAGGA
GTAGCCAAGGAGGAGTTCCAGGCCATCATCCGCGACCCCCTCATGCTCAACAGCGTCATC
CTCCTCCTCGCCAACAAGCAGGACCTGAAAGGGGCGATGAGCTCGTCGGAGGTGTGCCAG
CGGCTGGGGGCGTACGAGGAGCTCAAGAACCGGAGGTGGCACTGTCAGGGAGCCTCAGCG
CTCACCGGCGACGGCCTCCACGGCGGCCTCGACTGGCTGGCCTCCACCCTCCGCGACGTC
CAGACGTGGGGCACCTCCGTCCGCTTCTAG

CDS

570 bp

>Os06t0114200-00 Similar to ATARFB1B; GTP binding.
ATGGGGCAGTCCCTGAGGAAGCTGTTCGACAGCTTCTGCACAAAGGAGATGAAGGTTCTG
ATGCTTGGGCTGGATGCTGCTGGGAAGACGACGATTCTGTACAGGCTGCACATTGGCGAA
GTTCTGTCCTCCATACCCACAATCGGGTTCAACGTGGAGAAGGTGGAGTACAAGAACGTG
GCCTTCACGGTGTGGGACGTGGGAGGCCAGGACAAGCTCCGACCTCTCTGGAGACAATAC
TTCAGAAACGCCGACGCCCTGATCTACGTGGTTGATTCGATGGACAGGGAAAGGATAGGA
GTAGCCAAGGAGGAGTTCCAGGCCATCATCCGCGACCCCCTCATGCTCAACAGCGTCATC
CTCCTCCTCGCCAACAAGCAGGACCTGAAAGGGGCGATGAGCTCGTCGGAGGTGTGCCAG
CGGCTGGGGGCGTACGAGGAGCTCAAGAACCGGAGGTGGCACTGTCAGGGAGCCTCAGCG
CTCACCGGCGACGGCCTCCACGGCGGCCTCGACTGGCTGGCCTCCACCCTCCGCGACGTC
CAGACGTGGGGCACCTCCGTCCGCTTCTAG

Protein

190 aa

>Os06t0114200-00 Similar to ATARFB1B; GTP binding.
MGQSLRKLFDSFCTKEMKVLMLGLDAAGKTTILYRLHIGEVLSSIPTIGFNVEKVEYKNV
AFTVWDVGGQDKLRPLWRQYFRNADALIYVVDSMDRERIGVAKEEFQAIIRDPLMLNSVI
LLLANKQDLKGAMSSSEVCQRLGAYEELKNRRWHCQGASALTGDGLHGGLDWLASTLRDV
QTWGTSVRF*

CDS

chr06:819373..819426 (+ strand) : 54 bp

chr06:819536..819626 (+ strand) : 91 bp

chr06:819752..819867 (+ strand) : 116 bp

chr06:819961..820086 (+ strand) : 126 bp

chr06:820174..820356 (+ strand) : 183 bp

FASTA

>Os06t0114200-00 class=Sequence position=chr06:819373..820356 (+ strand)
ATGGGGCAGT CCCTGAGGAA GCTGTTCGAC AGCTTCTGCA CAAAGGAGAT GAAGGTAACA TCATGTCAGC ATTCTGAAAT
CGTTCACCAT TCTCAGTTTT TCATCCTTTC TGATGCTTAA CCAGGTTCAG AATTTTTTTC TCTTCTGATG GATGCTTAAT
CAGGTTCTGA TGCTTGGGCT GGATGCTGCT GGGAAGACGA CGATTCTGTA CAGGCTGCAC ATTGGCGAAG TTCTGTCCTC
CATACCCACA ATCGGTAGTG ATACATCGTG TTCATTGTCA TTTATTTCAT CGCCGAAATG GGCATGACAT AATCCATTCC
TGGACCTGCA TTGACAGACA TACATTCTTT CATCCTGTGA AATGAACGAA TTCCATCAGG GTTCAACGTG GAGAAGGTGG
AGTACAAGAA CGTGGCCTTC ACGGTGTGGG ACGTGGGAGG CCAGGACAAG CTCCGACCTC TCTGGAGACA ATACTTCAGA
AACGCCGACG CCCTGGTTAA ATCTCATCTT CTGAATCTCT CTCTCGATCG ATCATTGCTT TGCTTCTGAA ATCTGAATGT
CTGAAACTGA ATGTGTGGGG AGTTGCAGAT CTACGTGGTT GATTCGATGG ACAGGGAAAG GATAGGAGTA GCCAAGGAGG
AGTTCCAGGC CATCATCCGC GACCCCCTCA TGCTCAACAG CGTCATCCTC CTCCTCGCCA ACAAGCAGGA CCTGGTAATT
GCTAAAAGCT TGACGAATCA ATGAACAATT TGCCAATGGC GATTAGTTAT ACAACAATTG ACATGTGGAT GCATGATGCA
GAAAGGGGCG ATGAGCTCGT CGGAGGTGTG CCAGCGGCTG GGGGCGTACG AGGAGCTCAA GAACCGGAGG TGGCACTGTC
AGGGAGCCTC AGCGCTCACC GGCGACGGCC TCCACGGCGG CCTCGACTGG CTGGCCTCCA CCCTCCGCGA CGTCCAGACG
TGGGGCACCT CCGTCCGCTT CTAG

Locus: Os06g0114200

Loading...

Locus: Os06g0114200

Loading...