Os06t0116800-01

Locus

Os06g0116800

Description

DnaJ protein, Positive regulation of rice immunity against M. oryzae

RAP-DB Gene Symbol Synonym(s)

OsDjA9

RAP-DB Gene Name Synonym(s)

DnaJ protein A9

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA9

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A9

Transcript Evidence

AK058985

Protein Evidence

Q5VRK6

Literature

PMID: 33239288

Note

Manual Curation

November 27, 2020

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Chaperone J-domain superfamily (IPR036869)

HSP40/DnaJ peptide-binding (IPR008971)

Heat shock protein DnaJ, cysteine-rich domain superfamily (IPR036410)

Chaperone DnaJ (IPR012724)

DnaJ domain (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

DnaJ domain, conserved site (IPR018253)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

mitochondrion (GO:0005739)

endoplasmic reticulum (GO:0005783)

Full-length cDNA

001-020-E06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0116800-01)

Others

Oryzabase (12146)

KEGG (Os06t0116800-01)

Transcript

1681 bp

>Os06t0116800-01 DnaJ protein, Positive regulation of rice immunity against M. oryzae
acttcttaagccgcaagcacgcgacgcgacggcgaggccacacgacctcacctcgccacc
atgcggctccccggcgacgctcgcctcgccctcctcctcgctcgccgccgcgccctcccc
tcctcctcgcccgccgcgtcggcgtcccccttccacggctcgcgcgcccacggagcgagg
tggggcgacgcgtttcgcgccgcggctcccgcgtggaggtcgccgttctcctcgccgact
agtgccaggctcttccacgggacgaggccggtggcagcgagggactactacgatgtgctc
ggcgtgagcaggaacgcgagccagggggagatcaagaaagcgtattacgcgCTTGCGAAA
AAGCTCCATCCGGATACAAATAAAGGTGATTCTGATGCAGAGAGGAAGTTTCAAGAGGTT
CAGCGAGCTTATGAGACTTTGAAGGATGATCAGAAGAGATCATTATATGATCAGGTTGGC
CCTGATCAGTATGAGAAAGCTTCCGCTGGAGGAGGACCTGGTGGTGCATATGAAGGGGGT
TTTGGCAATCCGTTTGAGGATATTTTTGGTGGAGGTGGCGGCGGCGGTGGAATGAATGAT
TTCTTTAGAAACATATTCAGAGAGAGAGAATTTAGCGGGCATGATGCCAAGGTTGCACTT
GAAATATCATTTATGGAAGCAGTTCAGGGGTGCACAAAGACGATCAATTTTCAGACTGCT
GTTACATGTGACACCTGCAAGGGAGCTGGCGTACCCCCTGGAACCAAACCTGAAACTTGC
CTAGCCTGCAGGGGTTCAGGATTTATCTTCATGCAAACTGGTCCCTTCAGGATGCAATCA
ACATGCACACAGTGTGGTGGTAGTGGGAAGACTGTGAAGGAATTCTGCAAGTCATGCAAA
GGAAGGAAAGTTGTGCCAGGAACAAAAAACATCCGACTCAACATAGTGCCTGGTACGGAT
GATGGTGACGTTATAAAGTTGGTTAGATCAGGTGGAGCAGATCCAGATGGTGGTAGTCCT
GGTGATCTTTATGTAACTCTGAAGGTTCGTGAGGATCCGGTATTTCGAAGAGAGAAAGGT
GATATTCATGTAGATGCTGTATTGAACGTGACTCAGGCAATTTTGGGCGGGACAGTTCAG
GTTCCAACTCTCTCTGGAGATGTAGTTCTAAAGgtCAAGCCTGGTACTCAGCCTGGCCAA
AAGGTGGTTCTGAGAGGAAAAGGAATCAAGACGAGAAATTCATCGTACTATGGAGATCAG
TATGTCCACTTCAATGTCAACATCCCTGCGAATTTGACACCGAGACAGCGCGTGCTGATC
GAGGAATTTGCGAAGGAAGAGCAAGCTGAAGAGGAGAAAGACGCAAAGGCAGCAGGAGCA
TCGGGATAGCTGATTTTAGGAGCGACCCGTACATTTGATTAGTGCTTTAGTCTCATCATA
TATCGCGAGATAGAATAGGCTGCTGCCTGAAATTTGCAGGGGCAAGAAGATATAGTTTGG
TTGGATGCATGGAATTTTACATGCCGACATATAGCAGTTTCAAATTTTGTAGCTGGGAAT
AATATACACCACGCCGCCTGATGTTTGCAATCTCCTAATGTCACTAGCATCAGTGAGACA
GGCGGCAGGATCCTGTATTGTATAATTTTGTGTGTTAAGAAAGTATGGAACTCACGGTAC
C

CDS

1329 bp

>Os06t0116800-01 DnaJ protein, Positive regulation of rice immunity against M. oryzae
atgcggctccccggcgacgctcgcctcgccctcctcctcgctcgccgccgcgccctcccc
tcctcctcgcccgccgcgtcggcgtcccccttccacggctcgcgcgcccacggagcgagg
tggggcgacgcgtttcgcgccgcggctcccgcgtggaggtcgccgttctcctcgccgact
agtgccaggctcttccacgggacgaggccggtggcagcgagggactactacgatgtgctc
ggcgtgagcaggaacgcgagccagggggagatcaagaaagcgtattacgcgCTTGCGAAA
AAGCTCCATCCGGATACAAATAAAGGTGATTCTGATGCAGAGAGGAAGTTTCAAGAGGTT
CAGCGAGCTTATGAGACTTTGAAGGATGATCAGAAGAGATCATTATATGATCAGGTTGGC
CCTGATCAGTATGAGAAAGCTTCCGCTGGAGGAGGACCTGGTGGTGCATATGAAGGGGGT
TTTGGCAATCCGTTTGAGGATATTTTTGGTGGAGGTGGCGGCGGCGGTGGAATGAATGAT
TTCTTTAGAAACATATTCAGAGAGAGAGAATTTAGCGGGCATGATGCCAAGGTTGCACTT
GAAATATCATTTATGGAAGCAGTTCAGGGGTGCACAAAGACGATCAATTTTCAGACTGCT
GTTACATGTGACACCTGCAAGGGAGCTGGCGTACCCCCTGGAACCAAACCTGAAACTTGC
CTAGCCTGCAGGGGTTCAGGATTTATCTTCATGCAAACTGGTCCCTTCAGGATGCAATCA
ACATGCACACAGTGTGGTGGTAGTGGGAAGACTGTGAAGGAATTCTGCAAGTCATGCAAA
GGAAGGAAAGTTGTGCCAGGAACAAAAAACATCCGACTCAACATAGTGCCTGGTACGGAT
GATGGTGACGTTATAAAGTTGGTTAGATCAGGTGGAGCAGATCCAGATGGTGGTAGTCCT
GGTGATCTTTATGTAACTCTGAAGGTTCGTGAGGATCCGGTATTTCGAAGAGAGAAAGGT
GATATTCATGTAGATGCTGTATTGAACGTGACTCAGGCAATTTTGGGCGGGACAGTTCAG
GTTCCAACTCTCTCTGGAGATGTAGTTCTAAAGgtCAAGCCTGGTACTCAGCCTGGCCAA
AAGGTGGTTCTGAGAGGAAAAGGAATCAAGACGAGAAATTCATCGTACTATGGAGATCAG
TATGTCCACTTCAATGTCAACATCCCTGCGAATTTGACACCGAGACAGCGCGTGCTGATC
GAGGAATTTGCGAAGGAAGAGCAAGCTGAAGAGGAGAAAGACGCAAAGGCAGCAGGAGCA
TCGGGATAG

Protein

443 aa

>Os06t0116800-01 DnaJ protein, Positive regulation of rice immunity against M. oryzae
MRLPGDARLALLLARRRALPSSSPAASASPFHGSRAHGARWGDAFRAAAPAWRSPFSSPT
SARLFHGTRPVAARDYYDVLGVSRNASQGEIKKAYYALAKKLHPDTNKGDSDAERKFQEV
QRAYETLKDDQKRSLYDQVGPDQYEKASAGGGPGGAYEGGFGNPFEDIFGGGGGGGGMND
FFRNIFREREFSGHDAKVALEISFMEAVQGCTKTINFQTAVTCDTCKGAGVPPGTKPETC
LACRGSGFIFMQTGPFRMQSTCTQCGGSGKTVKEFCKSCKGRKVVPGTKNIRLNIVPGTD
DGDVIKLVRSGGADPDGGSPGDLYVTLKVREDPVFRREKGDIHVDAVLNVTQAILGGTVQ
VPTLSGDVVLKVKPGTQPGQKVVLRGKGIKTRNSSYYGDQYVHFNVNIPANLTPRQRVLI
EEFAKEEQAEEEKDAKAAGASG*

5'UTR

chr06:932524..932583 (- strand) : 60 bp

CDS

chr06:932409..932523 (- strand) : 115 bp

chr06:932216..932299 (- strand) : 84 bp

chr06:932017..932108 (- strand) : 92 bp

chr06:931451..931534 (- strand) : 84 bp

chr06:931323..931361 (- strand) : 39 bp

chr06:930833..930958 (- strand) : 126 bp

chr06:930371..930421 (- strand) : 51 bp

chr06:930206..930293 (- strand) : 88 bp

chr06:930046..930110 (- strand) : 65 bp

chr06:929869..929943 (- strand) : 75 bp

chr06:929330..929402 (- strand) : 73 bp

chr06:929144..929235 (- strand) : 92 bp

chr06:928825..928896 (- strand) : 72 bp

chr06:928256..928312 (- strand) : 57 bp

chr06:928121..928169 (- strand) : 49 bp

chr06:927820..927886 (- strand) : 67 bp

chr06:927636..927735 (- strand) : 100 bp

3'UTR

chr06:927344..927635 (- strand) : 292 bp

FASTA

>Os06t0116800-01 class=Sequence position=chr06:927344..932583 (- strand)
acttcttaag ccgcaagcac gcgacgcgac ggcgaggcca cacgacctca cctcgccacc atgcggctcc ccggcgacgc
tcgcctcgcc ctcctcctcg ctcgccgccg cgccctcccc tcctcctcgc ccgccgcgtc ggcgtccccc ttccacggct
cgcgcgccca cggaggtgag ccgccgccgc cgccctcatc cccgcactgt ggctctcccg atttcctggg atttccttcc
agtgtgactg atctttcttt ctggttggtt gctttggtgt gcagcgaggt ggggcgacgc gtttcgcgcc gcggctcccg
cgtggaggtc gccgttctcc tcgccgacta gtgccaggct cttccacggt gaggacaaca atggggaaaa aggggaagaa
gggagatgct gctgtttctg gtttggtgag cttggctgag tcgattggtg atgttggatt cgtgtggctc tgcagggacg
aggccggtgg cagcgaggga ctactacgat gtgctcggcg tgagcaggaa cgcgagccag ggggagatca agaaagcgta
ttacgcggta tggttggCTC TGGAATCAAG ACTATGTCAT GCTTAGGGTG TAAATTGAGC ACACCAACGC GGCACATCTT
AGTTCTATAT CGCAAGTCTT GAATTATAAA GTGAAGACTA AACTTTTAGT TGCTAATTTT AGTGATAGAC TTTGGAAGTT
CCCATCATTA CACTTCAGGA CTTGTGCATA GAAAGATCAT CACCCATTTG GATTTTGGAA CAGTAATGTT AACCGCAAGT
TGATGGGTAT CTACCAGTTT TTTTGTCTAC CAGAATGTTT CTGAAAAGTG GTTGATGGAC TCTTGAGTAA AGGGCAGTTG
AGGTTGTTTG ATTTACCATT TCTCATCCTC AATTTTAGTT ATGTATTAGC CTTGTGTTAA TATAGAAAAC ATTGGCATTT
CCTTTCCTTA TGCACCATCG AAAGAAAAAA AAAATCATCG CGTATTGTTT ACCTCACAAT CCCTTTTTTT TTCTTTGTTG
TCCTAAAAGC TTGCGAAAAA GCTCCATCCG GATACAAATA AAGGTGATTC TGATGCAGAG AGGAAGTTTC AAGAGGTTCA
GCGAGCTTAT GAGGTACAGT TTTCAGCATG GAATACATAG GTAAAGGTTA TTATTAGTTT CTGATAATAT ACTGAGACAT
ACTTATTTTT CCTTCTTTGC AGACTTTGAA GGATGATCAG AAGAGATCAT TATATGATCA GGTAACAATT TCAACCTATT
TAATTGAACA AATGCCAACA TTTTAGCTGT CAATGCCTAA GGTCTATTAT TTAAATTACC ATGGGTCTGG AACCTCAATT
TAGTGTTTAC CAAGGCCCTA GGCTGCCTGC CTAGGTAGGC TAGACAGGAA GGTGCTGCCA AGCCGCAAGC TTTCAATTAC
CTTGTAGAGC ACTGCCCAGA TTCATTAGTT ATCCTATTCT CATAATTAGT GGTAGTAATA ATTCAACTTG ACTATTATGT
GATTATTGCT TTTCGTTGCT ATACCCTAGG GTCAGAAGCT ATGTCTTAGA AGTTTACAAT ACAAGCTTTT GAACACAAAC
TTGTCCTTGA CATGATCTAT TACAGGTTGG CCCTGATCAG TATGAGAAAG CTTCCGCTGG AGGAGGACCT GGTGGTGCAT
ATGAAGGGGG TTTTGGCAAT CCGTTTGAGG ATATTTTTGG TGGAGGTGGC GGCGGCGGTG GAATGAATGA TGTATGCTAT
CTTTTGTTTA ATTATTTGTC ATCTGGTTTT ATTCTGGTGG TTCTGCTCCC ATTTAGTTTG TATTGTTTTC TATCACTCAT
GTTGCTGAGT ATATACAGAA AAAAGATACT GTTGTCTGGA AATTCATTTT ATCTTTGTAG TTTTATAGTT ATTGAATTGT
TTGAGTTTTA GCAGAAACTT GTGTCCTACA TACTGCGACA TTGCCTCTTT GATACTTTTT CCATAAGTGG TTTTCTGTTT
CTTTCATTGC ATTATTTAAT TATTTTACAG CTTGATAAAC AAATGGCATC TCATCATCCT TCATTTTATA GATGCTGATC
ACATAACCAC ATGCTCGTAT ACTTTAATCA TATGAGTATA ACGGCACTAA TATGACTTTT GTTGTCTGTG TGTATAATGA
AGTTCTTTAG AAACATATTC AGAGAGAGAG AATTTAGCGG GCATGATGCC AAGGTTAGCT CTATACTCAT TTTTTTTTCA
CCTATCATGT TTTTGCTCTG TGAATCGCAG TTTCATGTTC CATTCTACAG GTTGCACTTG AAATATCATT TATGGAAGCA
GTTCAGGGGT GCACAAAGAC GATCAATTTT CAGACTGCTG TTACATGTGA CACCTGCAGT ATGTAGATGC GCTTCTATTT
ACTGCACATA TCAAACTATC GATGTCCTTT GAATTGTTCC TAATCATCTA ATGAGAGTTC TTTGTTTTCC CAGAGGGAGC
TGGCGTACCC CCTGGAACCA AACCTGAAAC TTGCCTAGCC TGCAGGGGTT CAGGATTTGT TAGTTCTTCC TCTAGCACAA
TTATTTCTAT TTAATGTGGT ATCTCATTTA AATGTTAGTA CTGTGCTTAT TTGTCTTTGT TTTTCATGTG CTGTTGGAAG
ATCTTCATGC AAACTGGTCC CTTCAGGATG CAATCAACAT GCACACAGTG TGGTGGTAGT GGGAAGACTG TGAAGGTATG
ATGTCCCTTT GTGTTGATAA CCTGCAGTCA GGATAAATCA GTTATCTAGC CTTCAATAAA TCATCTAGGA GGTTAACTGT
TTAGAGTTGT TGTCCTTAGG ACATAAAATT CCGTACCTAC CTGACCAGAA TTGCTTTGTG ATGTAGGGTT CGGTATTTCT
AAATTTGACC ATCTTACAAT CCTTATTCAT TACGTGTATC AACCCCTCTG ATTTTTTTCA ATTTGTGGTC ATTTAACTTG
TGATGCAGGT GGTTGTTGAC TGCACCTAAG TCCAGTTGTC TGATATTAGA TATATGAATT GAAATCAGCC ACAACAATAA
CTTCTGAACC ATGCTGTTCT TTATGAAATA AATATGCACT TGACCTCTGA TGTTATATTT GCTCCTATAT ACCTTTTGTA
CAGTGTCTAG ATTCTGATTA GTCACGATGA GCTGGTGATT GCAATGTTCT TGTGTTGTTA GGAATTCTGC AAGTCATGCA
AAGGAAGGAA AGTTGTGCCA GGAACAAAAA ACATCCGACT CAACATAGTG CCTGGTAGTT TTCAAATTGT CAGCATTCAT
GTTATTTGTA CGCATATACT CTTATTTTGT GTTACTAAAT GTCCTTGAGC ATTATTCTGT TCATTCAGGT ACGGATGATG
GTGACGTTAT AAAGTTGGTT AGATCAGGTG GAGCAGATCC AGATGGTGGT AGTCCTGGTG ATCTTTATGT AACTCTGAAG
GTTAGTCCTC TGCACATTAG CAGTTATACC ATTGGCCAAT GAATGGTAAT AGGCAGTTGA AACCTTACTT TGGGATCAGA
CAGGACCAAG CACTCGGTGC AACTAGCTGT AGGTTGATCC CAGTGCAAGA GTAGTGtctg gtcatttgtt ccaattcttt
tccccttgat gcaatgatgc acggctctcc tgcatatttg agaaaaagAT GATAAGCAGA TGACCTTTGT AATGCTGTTT
TTTCCAGGTT CGTGAGGATC CGGTATTTCG AAGAGAGAAA GGTGATATTC ATGTAGATGC TGTATTGAAC GTGACTCAGG
TAAGTTGAGC CTGATTATTT TTTCTGCATC CTATGCTTAT ATTTGCCACT GCACAGCTCA GTAATGGACA TCCCTAGCGG
GAAAACAGAA AAACTCAGTT ACCGGCCATA CTTCGTTGTC ACTACATTCT GTTTTGGCTG AGCTGGTAAT CTGAGTGGGA
GTGTGGTAGT GGTCTGTAAG CAGGATTGTG CATAGCCTTC TAGGGCTGGG TGATAACAAG TTAGTGTTAG CAGATTATGT
CTGTTCCCTT TAATCTTAGA ACAAACTGTT GTTATTAGAC TGTTCCTTAT TTGCCACAGA GCAGGCAAAC AACAATTGTT
TTTCACAGTA GTTTGAATGT TAAAACTAGC TAAAGTATGT TATCTCTAGC GAGTAACGAT GCTGTGGTGA TTGTCTGATA
ATCTCTAGTG ATACTAAACA AAACTTGTAA TGTTGTCGAG TAGGCATCTC CTCCACAGTT CTCATATTTC ATCAGTATTC
AGATTAAGAT TAACTGCAAA CATCTTTGTA GGCAATTTTG GGCGGGACAG TTCAGGTTCC AACTCTCTCT GGAGATGTAG
TTCTAAAGGT ACCTCCAAAA TCAGtttacc ctcattttca atcttctcct ttgtttatta tgtcggaatt ctccatctgc
cttgcatatt acaggtCAAG CCTGGTACTC AGCCTGGCCA AAAGGTGGTT CTGAGAGGAA AAGGTAAACT GCACTACATA
GTGTTTACCT TTTCGTGGGG CAAAATTTTT TTTTTAGTTA GCATAAATTG CATATGGCTG CATGTTTAAT ACTTCATGCT
CAGTTACACA TCCAAGTAAA AATGGAGTCT GCAAGGGCCT TGTTTTATTA AAACCCAGTG CCGTCATGGC TCATAAATTT
GTAGCGGTTG ATACATTTCA TTTTGCCTAT AGTGATAAGC ATCACTTTAT CCTGCAGGAA TCAAGACGAG AAATTCATCG
TACTATGGAG ATCAGTATGT CCACTTCAAT GTCAACATCC CTGCGTAAGC TCTCCTCGGA ACTTACTGAA CTGCCCTATG
CTGTTACTAG TACTTCTGTT CAAATATTCA TGTATTACTT ATACACAGGA ATTTGACACC GAGACAGCGC GTGCTGATCG
AGGAATTTGC GAAGGAAGAG CAAGCTGAAG AGGAGAAAGA CGCAAAGGCA GCAGGAGCAT CGGGATAGCT GATTTTAGGA
GCGACCCGTA CATTTGATTA GTGCTTTAGT CTCATCATAT ATCGCGAGAT AGAATAGGCT GCTGCCTGAA ATTTGCAGGG
GCAAGAAGAT ATAGTTTGGT TGGATGCATG GAATTTTACA TGCCGACATA TAGCAGTTTC AAATTTTGTA GCTGGGAATA
ATATACACCA CGCCGCCTGA TGTTTGCAAT CTCCTAATGT CACTAGCATC AGTGAGACAG GCGGCAGGAT CCTGTATTGT
ATAATTTTGT GTGTTAAGAA AGTATGGAAC TCACGGTACC 

Locus: Os06g0116800

Loading...

Locus: Os06g0116800

Loading...