Os06t0116800-02

Locus

Os06g0116800

Description

Similar to GFA2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA9

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A9

Transcript Evidence

AK120746 (DDBJ, Best hit)

Protein Evidence

B6TA99 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ (IPR012724)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J023004K12 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0116800-02)

Others

Oryzabase (12146)

Transcript

1653 bp

>Os06t0116800-02 Similar to GFA2.
gaggccacacgacctcacctcgccaccatgcggctccccggcgacgctcgcctcgccctc
ctcctcgctcgccgccgcgccctcccctcctcctcgcccgccgcgtcggcgtcccccttc
cacggctcgcgcgcccacggagcgaggtggggcgacgcgtttcgcgccgcggctcccgcg
tggaggtcgccgttctcctcgccgactagtgccaggctcttccacgggacgaggccggtg
gcagcgagggactactacgatgtgctcggcgtgagcaggaacgcgagccagggggagatc
aagaaagcgtattacgcgCTTGCGAAAAAGCTCCATCCGGATACAAATAAAGGTGATTCT
GATGCAGAGAGGAAGTTTCAAGAGGTTCAGCGAGCTTATGAGACTTTGAAGGATGATCAG
AAGAGATCATTATATGATCAGGTTGGCCCTGATCAGTATGAGAAAGCTTCCGCTGGAGGA
GGACCTGGTGGTGCATATGAAGGGGGTTTTGGCAATCCGTTTGAGGATATTTTTGGTGGA
GGTGGCGGCGGCGGTGGAATGAATGATTTCTTTAGAAACATATTCAGAGAGAGAGAATTT
AGCGGGCATGATGCCAAGGTTGCACTTGAAATATCATTTATGGAAGCAGTTCAGGGGTGC
ACAAAGACGATCAATTTTCAGACTGCTGTTACATGTGACACCTGCAAGGGAGCTGGCGTA
CCCCCTGGAACCAAACCTGAAACTTGCCTAGCCTGCAGGGGTTCAGGATTTATCTTCATG
CAAACTGGTCCCTTCAGGATGCAATCAACATGCACACAGTGTGGTGGTAGTGGGAAGACT
GTGAAGGAATTCTGCAAGTCATGCAAAGGAAGGAAAGTTGTGCCAGGAACAAAAAACATC
CGACTCAACATAGTGCCTGGTACGGATGATGGTGACGTTATAAAGTTGGTTAGATCAGGT
GGAGCAGATCCAGATGGTGGTAGTCCTGGTGATCTTTATGTAACTCTGAAGGTTCGTGAG
GATCCGGTATTTCGAAGAGAGAAAGGTGATATTCATGTAGATGCTGTATTGAACGTGACT
CAGGCAATTTTGGGCGGGACAGTTCAGGTTCCAACTCTCTCTGGAGATGTAGTTCTAAAG
gtCAAGCCTGGTACTCAGCCTGGCCAAAAGGTGGTTCTGAGAGGAAAAGGAATCAAGACG
AGAAATTCATCGTACTATGGAGATCAGTATGTCCACTTCAATGTCAACATCCCTGCGAAT
TTGACACCGAGACAGCGCGTGCTGATCGAGGAATTTGCGAAGGAAGAGCAAGCTGAAGAG
GAGAAAGACGCAAAGGCAGCAGGAGCATCGGGATAGCTGATTTTAGGAGCGACCCGTACA
TTTGATTAGTGCTTTAGTCTCATCATATATCGCGAGATAGAATAGGCTGCTGCCTGAAAT
TTGCAGGGGCAAGAAGATATAGTTTGGTTGGATGCATGGAATTTTACATGCCGACATATA
GCAGTTTCAAATTTTGTAGCTGGGAATAATATACACCACGCCGCCTGATGTTTGCAATCT
CCTAATGTCACTAGCATCAGTGAGACAGGCGGCAGGATCCTGTATTGTATAATTTTGTGT
GTTAAGAAAGTATGGAACTCACGGTACCAACCT

CDS

1329 bp

>Os06t0116800-02 Similar to GFA2.
atgcggctccccggcgacgctcgcctcgccctcctcctcgctcgccgccgcgccctcccc
tcctcctcgcccgccgcgtcggcgtcccccttccacggctcgcgcgcccacggagcgagg
tggggcgacgcgtttcgcgccgcggctcccgcgtggaggtcgccgttctcctcgccgact
agtgccaggctcttccacgggacgaggccggtggcagcgagggactactacgatgtgctc
ggcgtgagcaggaacgcgagccagggggagatcaagaaagcgtattacgcgCTTGCGAAA
AAGCTCCATCCGGATACAAATAAAGGTGATTCTGATGCAGAGAGGAAGTTTCAAGAGGTT
CAGCGAGCTTATGAGACTTTGAAGGATGATCAGAAGAGATCATTATATGATCAGGTTGGC
CCTGATCAGTATGAGAAAGCTTCCGCTGGAGGAGGACCTGGTGGTGCATATGAAGGGGGT
TTTGGCAATCCGTTTGAGGATATTTTTGGTGGAGGTGGCGGCGGCGGTGGAATGAATGAT
TTCTTTAGAAACATATTCAGAGAGAGAGAATTTAGCGGGCATGATGCCAAGGTTGCACTT
GAAATATCATTTATGGAAGCAGTTCAGGGGTGCACAAAGACGATCAATTTTCAGACTGCT
GTTACATGTGACACCTGCAAGGGAGCTGGCGTACCCCCTGGAACCAAACCTGAAACTTGC
CTAGCCTGCAGGGGTTCAGGATTTATCTTCATGCAAACTGGTCCCTTCAGGATGCAATCA
ACATGCACACAGTGTGGTGGTAGTGGGAAGACTGTGAAGGAATTCTGCAAGTCATGCAAA
GGAAGGAAAGTTGTGCCAGGAACAAAAAACATCCGACTCAACATAGTGCCTGGTACGGAT
GATGGTGACGTTATAAAGTTGGTTAGATCAGGTGGAGCAGATCCAGATGGTGGTAGTCCT
GGTGATCTTTATGTAACTCTGAAGGTTCGTGAGGATCCGGTATTTCGAAGAGAGAAAGGT
GATATTCATGTAGATGCTGTATTGAACGTGACTCAGGCAATTTTGGGCGGGACAGTTCAG
GTTCCAACTCTCTCTGGAGATGTAGTTCTAAAGgtCAAGCCTGGTACTCAGCCTGGCCAA
AAGGTGGTTCTGAGAGGAAAAGGAATCAAGACGAGAAATTCATCGTACTATGGAGATCAG
TATGTCCACTTCAATGTCAACATCCCTGCGAATTTGACACCGAGACAGCGCGTGCTGATC
GAGGAATTTGCGAAGGAAGAGCAAGCTGAAGAGGAGAAAGACGCAAAGGCAGCAGGAGCA
TCGGGATAG

Protein

443 aa

>Os06t0116800-02 Similar to GFA2.
MRLPGDARLALLLARRRALPSSSPAASASPFHGSRAHGARWGDAFRAAAPAWRSPFSSPT
SARLFHGTRPVAARDYYDVLGVSRNASQGEIKKAYYALAKKLHPDTNKGDSDAERKFQEV
QRAYETLKDDQKRSLYDQVGPDQYEKASAGGGPGGAYEGGFGNPFEDIFGGGGGGGGMND
FFRNIFREREFSGHDAKVALEISFMEAVQGCTKTINFQTAVTCDTCKGAGVPPGTKPETC
LACRGSGFIFMQTGPFRMQSTCTQCGGSGKTVKEFCKSCKGRKVVPGTKNIRLNIVPGTD
DGDVIKLVRSGGADPDGGSPGDLYVTLKVREDPVFRREKGDIHVDAVLNVTQAILGGTVQ
VPTLSGDVVLKVKPGTQPGQKVVLRGKGIKTRNSSYYGDQYVHFNVNIPANLTPRQRVLI
EEFAKEEQAEEEKDAKAAGASG*

5'UTR

chr06:932524..932550 (- strand) : 27 bp

CDS

chr06:932409..932523 (- strand) : 115 bp

chr06:932216..932299 (- strand) : 84 bp

chr06:932017..932108 (- strand) : 92 bp

chr06:931451..931534 (- strand) : 84 bp

chr06:931323..931361 (- strand) : 39 bp

chr06:930833..930958 (- strand) : 126 bp

chr06:930371..930421 (- strand) : 51 bp

chr06:930206..930293 (- strand) : 88 bp

chr06:930046..930110 (- strand) : 65 bp

chr06:929869..929943 (- strand) : 75 bp

chr06:929330..929402 (- strand) : 73 bp

chr06:929144..929235 (- strand) : 92 bp

chr06:928825..928896 (- strand) : 72 bp

chr06:928256..928312 (- strand) : 57 bp

chr06:928121..928169 (- strand) : 49 bp

chr06:927820..927886 (- strand) : 67 bp

chr06:927636..927735 (- strand) : 100 bp

3'UTR

chr06:927339..927635 (- strand) : 297 bp

FASTA

>Os06t0116800-02 class=Sequence position=chr06:927339..932550 (- strand)
gaggccacac gacctcacct cgccaccatg cggctccccg gcgacgctcg cctcgccctc ctcctcgctc gccgccgcgc
cctcccctcc tcctcgcccg ccgcgtcggc gtcccccttc cacggctcgc gcgcccacgg aggtgagccg ccgccgccgc
cctcatcccc gcactgtggc tctcccgatt tcctgggatt tccttccagt gtgactgatc tttctttctg gttggttgct
ttggtgtgca gcgaggtggg gcgacgcgtt tcgcgccgcg gctcccgcgt ggaggtcgcc gttctcctcg ccgactagtg
ccaggctctt ccacggtgag gacaacaatg gggaaaaagg ggaagaaggg agatgctgct gtttctggtt tggtgagctt
ggctgagtcg attggtgatg ttggattcgt gtggctctgc agggacgagg ccggtggcag cgagggacta ctacgatgtg
ctcggcgtga gcaggaacgc gagccagggg gagatcaaga aagcgtatta cgcggtatgg ttggCTCTGG AATCAAGACT
ATGTCATGCT TAGGGTGTAA ATTGAGCACA CCAACGCGGC ACATCTTAGT TCTATATCGC AAGTCTTGAA TTATAAAGTG
AAGACTAAAC TTTTAGTTGC TAATTTTAGT GATAGACTTT GGAAGTTCCC ATCATTACAC TTCAGGACTT GTGCATAGAA
AGATCATCAC CCATTTGGAT TTTGGAACAG TAATGTTAAC CGCAAGTTGA TGGGTATCTA CCAGTTTTTT TGTCTACCAG
AATGTTTCTG AAAAGTGGTT GATGGACTCT TGAGTAAAGG GCAGTTGAGG TTGTTTGATT TACCATTTCT CATCCTCAAT
TTTAGTTATG TATTAGCCTT GTGTTAATAT AGAAAACATT GGCATTTCCT TTCCTTATGC ACCATCGAAA GAAAAAAAAA
ATCATCGCGT ATTGTTTACC TCACAATCCC TTTTTTTTTC TTTGTTGTCC TAAAAGCTTG CGAAAAAGCT CCATCCGGAT
ACAAATAAAG GTGATTCTGA TGCAGAGAGG AAGTTTCAAG AGGTTCAGCG AGCTTATGAG GTACAGTTTT CAGCATGGAA
TACATAGGTA AAGGTTATTA TTAGTTTCTG ATAATATACT GAGACATACT TATTTTTCCT TCTTTGCAGA CTTTGAAGGA
TGATCAGAAG AGATCATTAT ATGATCAGGT AACAATTTCA ACCTATTTAA TTGAACAAAT GCCAACATTT TAGCTGTCAA
TGCCTAAGGT CTATTATTTA AATTACCATG GGTCTGGAAC CTCAATTTAG TGTTTACCAA GGCCCTAGGC TGCCTGCCTA
GGTAGGCTAG ACAGGAAGGT GCTGCCAAGC CGCAAGCTTT CAATTACCTT GTAGAGCACT GCCCAGATTC ATTAGTTATC
CTATTCTCAT AATTAGTGGT AGTAATAATT CAACTTGACT ATTATGTGAT TATTGCTTTT CGTTGCTATA CCCTAGGGTC
AGAAGCTATG TCTTAGAAGT TTACAATACA AGCTTTTGAA CACAAACTTG TCCTTGACAT GATCTATTAC AGGTTGGCCC
TGATCAGTAT GAGAAAGCTT CCGCTGGAGG AGGACCTGGT GGTGCATATG AAGGGGGTTT TGGCAATCCG TTTGAGGATA
TTTTTGGTGG AGGTGGCGGC GGCGGTGGAA TGAATGATGT ATGCTATCTT TTGTTTAATT ATTTGTCATC TGGTTTTATT
CTGGTGGTTC TGCTCCCATT TAGTTTGTAT TGTTTTCTAT CACTCATGTT GCTGAGTATA TACAGAAAAA AGATACTGTT
GTCTGGAAAT TCATTTTATC TTTGTAGTTT TATAGTTATT GAATTGTTTG AGTTTTAGCA GAAACTTGTG TCCTACATAC
TGCGACATTG CCTCTTTGAT ACTTTTTCCA TAAGTGGTTT TCTGTTTCTT TCATTGCATT ATTTAATTAT TTTACAGCTT
GATAAACAAA TGGCATCTCA TCATCCTTCA TTTTATAGAT GCTGATCACA TAACCACATG CTCGTATACT TTAATCATAT
GAGTATAACG GCACTAATAT GACTTTTGTT GTCTGTGTGT ATAATGAAGT TCTTTAGAAA CATATTCAGA GAGAGAGAAT
TTAGCGGGCA TGATGCCAAG GTTAGCTCTA TACTCATTTT TTTTTCACCT ATCATGTTTT TGCTCTGTGA ATCGCAGTTT
CATGTTCCAT TCTACAGGTT GCACTTGAAA TATCATTTAT GGAAGCAGTT CAGGGGTGCA CAAAGACGAT CAATTTTCAG
ACTGCTGTTA CATGTGACAC CTGCAGTATG TAGATGCGCT TCTATTTACT GCACATATCA AACTATCGAT GTCCTTTGAA
TTGTTCCTAA TCATCTAATG AGAGTTCTTT GTTTTCCCAG AGGGAGCTGG CGTACCCCCT GGAACCAAAC CTGAAACTTG
CCTAGCCTGC AGGGGTTCAG GATTTGTTAG TTCTTCCTCT AGCACAATTA TTTCTATTTA ATGTGGTATC TCATTTAAAT
GTTAGTACTG TGCTTATTTG TCTTTGTTTT TCATGTGCTG TTGGAAGATC TTCATGCAAA CTGGTCCCTT CAGGATGCAA
TCAACATGCA CACAGTGTGG TGGTAGTGGG AAGACTGTGA AGGTATGATG TCCCTTTGTG TTGATAACCT GCAGTCAGGA
TAAATCAGTT ATCTAGCCTT CAATAAATCA TCTAGGAGGT TAACTGTTTA GAGTTGTTGT CCTTAGGACA TAAAATTCCG
TACCTACCTG ACCAGAATTG CTTTGTGATG TAGGGTTCGG TATTTCTAAA TTTGACCATC TTACAATCCT TATTCATTAC
GTGTATCAAC CCCTCTGATT TTTTTCAATT TGTGGTCATT TAACTTGTGA TGCAGGTGGT TGTTGACTGC ACCTAAGTCC
AGTTGTCTGA TATTAGATAT ATGAATTGAA ATCAGCCACA ACAATAACTT CTGAACCATG CTGTTCTTTA TGAAATAAAT
ATGCACTTGA CCTCTGATGT TATATTTGCT CCTATATACC TTTTGTACAG TGTCTAGATT CTGATTAGTC ACGATGAGCT
GGTGATTGCA ATGTTCTTGT GTTGTTAGGA ATTCTGCAAG TCATGCAAAG GAAGGAAAGT TGTGCCAGGA ACAAAAAACA
TCCGACTCAA CATAGTGCCT GGTAGTTTTC AAATTGTCAG CATTCATGTT ATTTGTACGC ATATACTCTT ATTTTGTGTT
ACTAAATGTC CTTGAGCATT ATTCTGTTCA TTCAGGTACG GATGATGGTG ACGTTATAAA GTTGGTTAGA TCAGGTGGAG
CAGATCCAGA TGGTGGTAGT CCTGGTGATC TTTATGTAAC TCTGAAGGTT AGTCCTCTGC ACATTAGCAG TTATACCATT
GGCCAATGAA TGGTAATAGG CAGTTGAAAC CTTACTTTGG GATCAGACAG GACCAAGCAC TCGGTGCAAC TAGCTGTAGG
TTGATCCCAG TGCAAGAGTA GTGtctggtc atttgttcca attcttttcc ccttgatgca atgatgcacg gctctcctgc
atatttgaga aaaagATGAT AAGCAGATGA CCTTTGTAAT GCTGTTTTTT CCAGGTTCGT GAGGATCCGG TATTTCGAAG
AGAGAAAGGT GATATTCATG TAGATGCTGT ATTGAACGTG ACTCAGGTAA GTTGAGCCTG ATTATTTTTT CTGCATCCTA
TGCTTATATT TGCCACTGCA CAGCTCAGTA ATGGACATCC CTAGCGGGAA AACAGAAAAA CTCAGTTACC GGCCATACTT
CGTTGTCACT ACATTCTGTT TTGGCTGAGC TGGTAATCTG AGTGGGAGTG TGGTAGTGGT CTGTAAGCAG GATTGTGCAT
AGCCTTCTAG GGCTGGGTGA TAACAAGTTA GTGTTAGCAG ATTATGTCTG TTCCCTTTAA TCTTAGAACA AACTGTTGTT
ATTAGACTGT TCCTTATTTG CCACAGAGCA GGCAAACAAC AATTGTTTTT CACAGTAGTT TGAATGTTAA AACTAGCTAA
AGTATGTTAT CTCTAGCGAG TAACGATGCT GTGGTGATTG TCTGATAATC TCTAGTGATA CTAAACAAAA CTTGTAATGT
TGTCGAGTAG GCATCTCCTC CACAGTTCTC ATATTTCATC AGTATTCAGA TTAAGATTAA CTGCAAACAT CTTTGTAGGC
AATTTTGGGC GGGACAGTTC AGGTTCCAAC TCTCTCTGGA GATGTAGTTC TAAAGGTACC TCCAAAATCA Gtttaccctc
attttcaatc ttctcctttg tttattatgt cggaattctc catctgcctt gcatattaca ggtCAAGCCT GGTACTCAGC
CTGGCCAAAA GGTGGTTCTG AGAGGAAAAG GTAAACTGCA CTACATAGTG TTTACCTTTT CGTGGGGCAA AATTTTTTTT
TTAGTTAGCA TAAATTGCAT ATGGCTGCAT GTTTAATACT TCATGCTCAG TTACACATCC AAGTAAAAAT GGAGTCTGCA
AGGGCCTTGT TTTATTAAAA CCCAGTGCCG TCATGGCTCA TAAATTTGTA GCGGTTGATA CATTTCATTT TGCCTATAGT
GATAAGCATC ACTTTATCCT GCAGGAATCA AGACGAGAAA TTCATCGTAC TATGGAGATC AGTATGTCCA CTTCAATGTC
AACATCCCTG CGTAAGCTCT CCTCGGAACT TACTGAACTG CCCTATGCTG TTACTAGTAC TTCTGTTCAA ATATTCATGT
ATTACTTATA CACAGGAATT TGACACCGAG ACAGCGCGTG CTGATCGAGG AATTTGCGAA GGAAGAGCAA GCTGAAGAGG
AGAAAGACGC AAAGGCAGCA GGAGCATCGG GATAGCTGAT TTTAGGAGCG ACCCGTACAT TTGATTAGTG CTTTAGTCTC
ATCATATATC GCGAGATAGA ATAGGCTGCT GCCTGAAATT TGCAGGGGCA AGAAGATATA GTTTGGTTGG ATGCATGGAA
TTTTACATGC CGACATATAG CAGTTTCAAA TTTTGTAGCT GGGAATAATA TACACCACGC CGCCTGATGT TTGCAATCTC
CTAATGTCAC TAGCATCAGT GAGACAGGCG GCAGGATCCT GTATTGTATA ATTTTGTGTG TTAAGAAAGT ATGGAACTCA
CGGTACCAAC CT

Locus: Os06g0116800

Loading...

Locus: Os06g0116800

Loading...