Os06t0125400-00

Locus

Os06g0125400

Description

Similar to Oligopeptide transporter 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT2

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 2

Transcript Evidence

ab initio prediction

Protein Evidence

B6SVF4 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Oligopeptide transporter OPT superfamily (IPR004813)

Expression Databases

TENOR (Os06t0125400-00)

Others

Oryzabase (12495)

Transcript

2292 bp

>Os06t0125400-00 Similar to Oligopeptide transporter 9.
ATGGCGTCCTCCCACCAAGAAGACCGCGAGGAGGAGGAGGAGCACAGCCATGGCGACGAC
GAGATCACCGCCCCGTTCTTGCGGCCATCGACGTCGAGGGGGTCGCCGGAGTTGGAGGAG
GAGGAGAACTCGCCGATCGAGCAGGTGGCGCTGACGGTGCCGGTGAGCGACGAGCCGGAG
ACGCCGGTGCTGACGTTCAGGATGTGGGTGCTGGGGACGGCGTCGTGCGCGGTGCTCTCC
TTCCTCAACCAGTTCTTCTGGTACCGCAAGGAGCCGCTCACCATCACCGCCATCTCGGCG
CAGATCGCCGTCGTGCCGCTCGGCCGCCTCATGGCGGCGGCGCTGCCGGAGCGCGCCTTC
TTCCGTGGGCGGCCGTGGGAGTTCACGCTCAACCCGGGGCCGTTCAATGTCAAGGAGCAC
GTGCTCATCACCATCTTCGCCAACTCCGGCGCCGGCACGGTGTACGCCATCCACGTCATC
ACCGCCGTCCGCGTCTTCTACGGCAAGCACATCTCCTTCTTCGTCTCCCTCCTCGTCGTC
CTCACCACCCAGGTTGTGGATGATCAGGTGCTTGGATTCGGGTGGGCGGGAATATTCCGG
CGGTATCTGGTGGAGCCGGCGGCGATGTGGTGGCCGTCCAACCTCGTGCAGGTCTCCCTC
TTCAGGGCGCTTCACGAGAAGGAAGCAAGGAGCAAAGGTGGGCTGACGCGCAACCAGTTC
TTCCTTGTGGCATTCATCTGCAGCTTCGCATACTACATCTTCCCAGGCTACCTGTTCCAG
ATGCTCACCTCCCTCTCCTGGATCTGCTGGGTCTTCCCCCACTCTGTGCTTGCACAGCAG
CTCGGCTCAGGTCTCAGTGGCCTTGGCATTGGCGCGATCGGTCTCGACTGGTCCACCGTC
TCCTCCTACCTCGGGAGTCCTCTTGCTAGCCCATGGTTTGCCACTGCAAATGTTGCTGCT
GGCTTCTTCTTCATCATGTACATAATCACACCGATTGCTTACTGGTTCAATTTCTACAAG
GCACAAAACTTCCCCATATTTTCTGATGGTCTCTTCACCTCAACTGGCCAAAAGTACAAT
ATCTCAAGCATTGTTGATTCTCATTTCCATTTCGACACAAAGGCCTACGAGAAGAATGGT
CCACTATACCTCAGCACTTTCTTTGCTGTCACATATGGCGTTGGTTTTGCATCCCTTACC
GCAACAATTGTTCATGTTCTCCTCTTCCACGGAAGTGAAATATGGCAATTAAGTAAATCA
GCTTTCCAAGAAAAAAGGATGGACATACATACAAAACTTATGAGGAGATATAAGCAGGTT
CCTGAGTGGTGGTTTGTCTGCATCCTCATTGCTAACATTGCCGTCACCATATTTGCTTGT
GAATACTACATTGAGCAACTCCAGTTGCCCTGGTGGGGTGTTTTACTTGCATGTGCCATT
GCCTTCTTCTTCACCCTCCCAATTGGGATAATTACAGCAACAACGAACCAGACTCCAGGC
TTGAACATCATCACAGAGTATATCATGGGGTACTTGTACCCTGGACGACCGGTAGCAAAT
ATGTGTTTCAAGGTATATGGTTACATCAGCATGAGCCAGGCCCTGACATTTCTTCAAGAT
TTTAAGTTGGGTCACTACATGAAGATTCCACCAAGGACCATGTTTATGGCTCAGGTGGTG
GGAACTTTGATTGCAGCATTTGTGTACATTGGAACGGCATGGTGGCTGATGGAGACAATT
CCCAACATCTGTAACACTGAGCTCCTCCCATCAGATAGCCCTTGGACCTGCCCAGGAGAT
CATGTGTTCTATGATGCATCAGTCATATGGGGTCTTATTAGCCCACGCAGAATATTTGGG
GACTTAGGCACCTACTCGGCGGTAAACTGGTTCTTTTTGGGTGGAGCTATTGCCCCTGTC
CTTGTCTGGTTTGCACACAAGGCATTCCCAAACCAGAACTGGATCTTGCTCATAAACATG
CCTGTGCTGATTGGTGCCACTGGCCAGATGCCGCCTGCCACTGCCGTCAACTACACAACA
TGGATACTTGTTGGTTTCTTGTCAGGTTATGTGGTCTATAGATATCGACGTGACTGGTGG
GAGCGGCACAATTATCTGCTTTCAGGTGCATTGGATGCTGGTTTGGCATTCATGGCTGTT
TTGATTTACTTGTGCCTAGGCTTGGAGAACATCAGTTTGAACTGGTGGGGCAATGACTTG
GATGGATGTCCTCTGGCTTCTTGCCCCACTGCTAAAGGTGTAGTTGTTGACGGATGCCCA
GTCTATACTTGA

CDS

2292 bp

>Os06t0125400-00 Similar to Oligopeptide transporter 9.
ATGGCGTCCTCCCACCAAGAAGACCGCGAGGAGGAGGAGGAGCACAGCCATGGCGACGAC
GAGATCACCGCCCCGTTCTTGCGGCCATCGACGTCGAGGGGGTCGCCGGAGTTGGAGGAG
GAGGAGAACTCGCCGATCGAGCAGGTGGCGCTGACGGTGCCGGTGAGCGACGAGCCGGAG
ACGCCGGTGCTGACGTTCAGGATGTGGGTGCTGGGGACGGCGTCGTGCGCGGTGCTCTCC
TTCCTCAACCAGTTCTTCTGGTACCGCAAGGAGCCGCTCACCATCACCGCCATCTCGGCG
CAGATCGCCGTCGTGCCGCTCGGCCGCCTCATGGCGGCGGCGCTGCCGGAGCGCGCCTTC
TTCCGTGGGCGGCCGTGGGAGTTCACGCTCAACCCGGGGCCGTTCAATGTCAAGGAGCAC
GTGCTCATCACCATCTTCGCCAACTCCGGCGCCGGCACGGTGTACGCCATCCACGTCATC
ACCGCCGTCCGCGTCTTCTACGGCAAGCACATCTCCTTCTTCGTCTCCCTCCTCGTCGTC
CTCACCACCCAGGTTGTGGATGATCAGGTGCTTGGATTCGGGTGGGCGGGAATATTCCGG
CGGTATCTGGTGGAGCCGGCGGCGATGTGGTGGCCGTCCAACCTCGTGCAGGTCTCCCTC
TTCAGGGCGCTTCACGAGAAGGAAGCAAGGAGCAAAGGTGGGCTGACGCGCAACCAGTTC
TTCCTTGTGGCATTCATCTGCAGCTTCGCATACTACATCTTCCCAGGCTACCTGTTCCAG
ATGCTCACCTCCCTCTCCTGGATCTGCTGGGTCTTCCCCCACTCTGTGCTTGCACAGCAG
CTCGGCTCAGGTCTCAGTGGCCTTGGCATTGGCGCGATCGGTCTCGACTGGTCCACCGTC
TCCTCCTACCTCGGGAGTCCTCTTGCTAGCCCATGGTTTGCCACTGCAAATGTTGCTGCT
GGCTTCTTCTTCATCATGTACATAATCACACCGATTGCTTACTGGTTCAATTTCTACAAG
GCACAAAACTTCCCCATATTTTCTGATGGTCTCTTCACCTCAACTGGCCAAAAGTACAAT
ATCTCAAGCATTGTTGATTCTCATTTCCATTTCGACACAAAGGCCTACGAGAAGAATGGT
CCACTATACCTCAGCACTTTCTTTGCTGTCACATATGGCGTTGGTTTTGCATCCCTTACC
GCAACAATTGTTCATGTTCTCCTCTTCCACGGAAGTGAAATATGGCAATTAAGTAAATCA
GCTTTCCAAGAAAAAAGGATGGACATACATACAAAACTTATGAGGAGATATAAGCAGGTT
CCTGAGTGGTGGTTTGTCTGCATCCTCATTGCTAACATTGCCGTCACCATATTTGCTTGT
GAATACTACATTGAGCAACTCCAGTTGCCCTGGTGGGGTGTTTTACTTGCATGTGCCATT
GCCTTCTTCTTCACCCTCCCAATTGGGATAATTACAGCAACAACGAACCAGACTCCAGGC
TTGAACATCATCACAGAGTATATCATGGGGTACTTGTACCCTGGACGACCGGTAGCAAAT
ATGTGTTTCAAGGTATATGGTTACATCAGCATGAGCCAGGCCCTGACATTTCTTCAAGAT
TTTAAGTTGGGTCACTACATGAAGATTCCACCAAGGACCATGTTTATGGCTCAGGTGGTG
GGAACTTTGATTGCAGCATTTGTGTACATTGGAACGGCATGGTGGCTGATGGAGACAATT
CCCAACATCTGTAACACTGAGCTCCTCCCATCAGATAGCCCTTGGACCTGCCCAGGAGAT
CATGTGTTCTATGATGCATCAGTCATATGGGGTCTTATTAGCCCACGCAGAATATTTGGG
GACTTAGGCACCTACTCGGCGGTAAACTGGTTCTTTTTGGGTGGAGCTATTGCCCCTGTC
CTTGTCTGGTTTGCACACAAGGCATTCCCAAACCAGAACTGGATCTTGCTCATAAACATG
CCTGTGCTGATTGGTGCCACTGGCCAGATGCCGCCTGCCACTGCCGTCAACTACACAACA
TGGATACTTGTTGGTTTCTTGTCAGGTTATGTGGTCTATAGATATCGACGTGACTGGTGG
GAGCGGCACAATTATCTGCTTTCAGGTGCATTGGATGCTGGTTTGGCATTCATGGCTGTT
TTGATTTACTTGTGCCTAGGCTTGGAGAACATCAGTTTGAACTGGTGGGGCAATGACTTG
GATGGATGTCCTCTGGCTTCTTGCCCCACTGCTAAAGGTGTAGTTGTTGACGGATGCCCA
GTCTATACTTGA

Protein

764 aa

>Os06t0125400-00 Similar to Oligopeptide transporter 9.
MASSHQEDREEEEEHSHGDDEITAPFLRPSTSRGSPELEEEENSPIEQVALTVPVSDEPE
TPVLTFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAAALPERAF
FRGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITAVRVFYGKHISFFVSLLVV
LTTQVVDDQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKEARSKGGLTRNQF
FLVAFICSFAYYIFPGYLFQMLTSLSWICWVFPHSVLAQQLGSGLSGLGIGAIGLDWSTV
SSYLGSPLASPWFATANVAAGFFFIMYIITPIAYWFNFYKAQNFPIFSDGLFTSTGQKYN
ISSIVDSHFHFDTKAYEKNGPLYLSTFFAVTYGVGFASLTATIVHVLLFHGSEIWQLSKS
AFQEKRMDIHTKLMRRYKQVPEWWFVCILIANIAVTIFACEYYIEQLQLPWWGVLLACAI
AFFFTLPIGIITATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYISMSQALTFLQD
FKLGHYMKIPPRTMFMAQVVGTLIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTCPGD
HVFYDASVIWGLISPRRIFGDLGTYSAVNWFFLGGAIAPVLVWFAHKAFPNQNWILLINM
PVLIGATGQMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAFMAV
LIYLCLGLENISLNWWGNDLDGCPLASCPTAKGVVVDGCPVYT*

CDS

chr06:1368905..1368983 (- strand) : 79 bp

chr06:1368343..1368815 (- strand) : 473 bp

chr06:1368065..1368177 (- strand) : 113 bp

chr06:1366550..1367119 (- strand) : 570 bp

chr06:1366214..1366469 (- strand) : 256 bp

chr06:1365940..1366122 (- strand) : 183 bp

chr06:1365218..1365835 (- strand) : 618 bp

FASTA

>Os06t0125400-00 class=Sequence position=chr06:1365218..1368983 (- strand)
ATGGCGTCCT CCCACCAAGA AGACCGCGAG GAGGAGGAGG AGCACAGCCA TGGCGACGAC GAGATCACCG CCCCGTTCTG
TAAGCTCAGC AAGATCGTCG TCATCGAAGC TTAGCTCATA GCTTTTTCCG GTTGGTTGCT GCTCTGATCG GATCATGTGT
ATATGCAGTG CGGCCATCGA CGTCGAGGGG GTCGCCGGAG TTGGAGGAGG AGGAGAACTC GCCGATCGAG CAGGTGGCGC
TGACGGTGCC GGTGAGCGAC GAGCCGGAGA CGCCGGTGCT GACGTTCAGG ATGTGGGTGC TGGGGACGGC GTCGTGCGCG
GTGCTCTCCT TCCTCAACCA GTTCTTCTGG TACCGCAAGG AGCCGCTCAC CATCACCGCC ATCTCGGCGC AGATCGCCGT
CGTGCCGCTC GGCCGCCTCA TGGCGGCGGC GCTGCCGGAG CGCGCCTTCT TCCGTGGGCG GCCGTGGGAG TTCACGCTCA
ACCCGGGGCC GTTCAATGTC AAGGAGCACG TGCTCATCAC CATCTTCGCC AACTCCGGCG CCGGCACGGT GTACGCCATC
CACGTCATCA CCGCCGTCCG CGTCTTCTAC GGCAAGCACA TCTCCTTCTT CGTCTCCCTC CTCGTCGTCC TCACCACCCA
GGTACCGTAC GTCACCTTGC TAGTTGCTAC CATCCATGGC AGATCGAAAG TGACTTTGTT TTTTCTTTAG ATTTCTTGTC
GTCTTCAACC ATCGATCATT CGATCGATCA GGTTATATGC ATGATTGTTT TTGCGTTTGG TGTTCGTGTC GTGTAATGCG
ATCGAGGTTG TGGATGATCA GGTGCTTGGA TTCGGGTGGG CGGGAATATT CCGGCGGTAT CTGGTGGAGC CGGCGGCGAT
GTGGTGGCCG TCCAACCTCG TGCAGGTCTC CCTCTTCAGG TACCTACCAT TCCTCTCTTC AACCAGCACA TCTAGCTAGT
ATTTCTTTTT TAAGAAAATC ATTTTTTTCT TTTGTTTAAG AATGAAGAGC AAATTTAAAA TCGGTTCATG TGTATCTCAT
CTTGATTGAT TAGAGATATT TTTGGCATTG ATTATATACC TTAATTAATC AGCTGGAACA TAGAGGTTGG ACTTTGAATT
AGTACTCCAA AATTTAGTGG TTGGACAGAG CTTGCTTTCT GCTGGTAAAA CTATGAAAAT TAAATTAAAT GTAAATATGT
GTGAGATGCG TATGCTTGCA CGTAGGTGTT TAATTTGACG TTTCAGTTGT AAGACTCTCG CGCGTTTTGA TAAGCGATTG
ATCGATCGAT GAATCAAATG CCAAGTTAGC CAGCTGTCAC TAATCATGAC ACGTCAGACT GGTCCTGCTT GCATTCAAGA
GCATCAAAGA GGCTGGAATA GTTTGGGTCC TACAAGAAAA TGAAACGGTT CAAACAAAAG AAGAGAAAAA TATATGCATT
CACATCACAC AACATTTAGC AAATATAGTT AATGCAAACA GCAAAACCGT ATAAACTGCC CATCATTGAG CTGGACAAGA
TGTGACCATT AATTAACTCG TGCTGTCTAA ATTAATTTTT TTACGGTAAA TTAAATTTGT TAGAGATTCG TAAGTTCAAT
GAATTGGTGG CCTCCCCAGG TCCCAGCCAT GTAGGGTAGG AGGGCATATG ATCCGGCCCA ATAACAAGGC CCAGTTCGGG
CTAATTTGTG GCCCAACACA GCTACATCCA CCAGTTCTTC CCCAGATCAT CAGCAAGGAT CAAATGACCT TTTAAAGCCA
AAGAACTTGG TACAAATGTT TGCAAGGATC AAATGACCTT TTAAAGCCAA AGAACTTGGT ACTAAATGCA ACTTACACAT
TTGCAAATGT ATTTTGCTCA TCAGGGCGCT TCACGAGAAG GAAGCAAGGA GCAAAGGTGG GCTGACGCGC AACCAGTTCT
TCCTTGTGGC ATTCATCTGC AGCTTCGCAT ACTACATCTT CCCAGGCTAC CTGTTCCAGA TGCTCACCTC CCTCTCCTGG
ATCTGCTGGG TCTTCCCCCA CTCTGTGCTT GCACAGCAGC TCGGCTCAGG TCTCAGTGGC CTTGGCATTG GCGCGATCGG
TCTCGACTGG TCCACCGTCT CCTCCTACCT CGGGAGTCCT CTTGCTAGCC CATGGTTTGC CACTGCAAAT GTTGCTGCTG
GCTTCTTCTT CATCATGTAC ATAATCACAC CGATTGCTTA CTGGTTCAAT TTCTACAAGG CACAAAACTT CCCCATATTT
TCTGATGGTC TCTTCACCTC AACTGGCCAA AAGTACAATA TCTCAAGCAT TGTTGATTCT CATTTCCATT TCGACACAAA
GGCCTACGAG AAGAATGGTC CACTATACCT CAGCACTTTC TTTGCTGTCA CATATGGCGT TGGTTTTGCA TCCCTTACCG
CAACAATTGT TCATGTTCTC CTCTTCCACG GAAGGTAAGT TTCATCTGGA ATTGGACAGT CTATTGCCTG CGATATAAAA
TGAAGTAGGT AAGAATCATA ATGTTTGCTT TCAGTGAAAT ATGGCAATTA AGTAAATCAG CTTTCCAAGA AAAAAGGATG
GACATACATA CAAAACTTAT GAGGAGATAT AAGCAGGTTC CTGAGTGGTG GTTTGTCTGC ATCCTCATTG CTAACATTGC
CGTCACCATA TTTGCTTGTG AATACTACAT TGAGCAACTC CAGTTGCCCT GGTGGGGTGT TTTACTTGCA TGTGCCATTG
CCTTCTTCTT CACCCTCCCA ATTGGGATAA TTACAGCAAC AACGAACCAG GTACAAATTA AATTTTAATA CCTTGTGCAT
ATTATGTCAT ATAGCTCTAG AGCAAACAGT TCAGCACTTC ATCATTTCCC ATCGTGTGCA GACTCCAGGC TTGAACATCA
TCACAGAGTA TATCATGGGG TACTTGTACC CTGGACGACC GGTAGCAAAT ATGTGTTTCA AGGTATATGG TTACATCAGC
ATGAGCCAGG CCCTGACATT TCTTCAAGAT TTTAAGTTGG GTCACTACAT GAAGATTCCA CCAAGGACCA TGTTTATGGC
TCAGGTTAGC TTTACTAGCC ATTTAGTTTA TCTGCCATTT CTCCTAAAAG AAGTAAAAAC ATGATCCTGC TGCATTGTGC
CACTAATGAA CTTCTTGGAA CATGGCAGGT GGTGGGAACT TTGATTGCAG CATTTGTGTA CATTGGAACG GCATGGTGGC
TGATGGAGAC AATTCCCAAC ATCTGTAACA CTGAGCTCCT CCCATCAGAT AGCCCTTGGA CCTGCCCAGG AGATCATGTG
TTCTATGATG CATCAGTCAT ATGGGGTCTT ATTAGCCCAC GCAGAATATT TGGGGACTTA GGCACCTACT CGGCGGTAAA
CTGGTTCTTT TTGGGTGGAG CTATTGCCCC TGTCCTTGTC TGGTTTGCAC ACAAGGCATT CCCAAACCAG AACTGGATCT
TGCTCATAAA CATGCCTGTG CTGATTGGTG CCACTGGCCA GATGCCGCCT GCCACTGCCG TCAACTACAC AACATGGATA
CTTGTTGGTT TCTTGTCAGG TTATGTGGTC TATAGATATC GACGTGACTG GTGGGAGCGG CACAATTATC TGCTTTCAGG
TGCATTGGAT GCTGGTTTGG CATTCATGGC TGTTTTGATT TACTTGTGCC TAGGCTTGGA GAACATCAGT TTGAACTGGT
GGGGCAATGA CTTGGATGGA TGTCCTCTGG CTTCTTGCCC CACTGCTAAA GGTGTAGTTG TTGACGGATG CCCAGTCTAT
ACTTGA

Locus: Os06g0125400

Loading...

Locus: Os06g0125400

Loading...