Os06t0125500-01

Locus

Os06g0125500

Description

Similar to Oligopeptide transporter 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT3, OsGT1

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 3, glutathione transporter 1

Transcript Evidence

AK072127 (DDBJ, Best hit)

Protein Evidence

B6SVF4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J013124E13 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0125500-01)

RiceXPro (AK072127)

Others

Oryzabase (12496)

KEGG (Os06t0125500-01)

Transcript

3206 bp

>Os06t0125500-01 Similar to Oligopeptide transporter 9.
ATTGACGAACCGGAGGAACCAAAACGACCACGCGTGAGAACTGAGAAGGCTCGCAGCACA
CACAACCATGATGCTCCACCACGAAGCAAGTGTGCAACAAGCGCGAGAGGAAGAAGAAGA
GCTTGATCACCATGGCGATCCGATGATCACCTCCCCTCTCTTGCGACCATCGACGTCGGG
CAGCTCGCCGGAGAATGGAGAGGAGGAGAACTCACCGGTGGAGCTGGTGGCGCTGACGGT
GCCAGTGAGCGACGAGCCGGAGACGCCGGTGCTGACGTTCAGGATGTGGGTGCTGGGGAC
GGCGTCGTGCGCGGTGCTCTCCTTCCTTAACCAGTTCTTCTGGTACCGCAAGGAGCCGCT
CACCATCACCGCCATCTCCGCGCAGATCGCCGTCGTGCCGCTCGGCCGCCTCATGGCGGC
GACGCTGCCGGAGCACGCCTTCTTCCGTGGCCGGCCGTGGGAGTTCACGCTTAATCCGGG
GCCGTTCAATGTCAAGGAGCACGTGCTCATCACCATCTTCGCCAACTCCGGCGCCGGCAC
CGTCTATGCCATCCACGTCATCACCGGCGTCCGTGTCTTCTACGGGAAAACCCTCTCCTT
CTTCATCTCCCTCCTTGTCGTCCTCACAACACAGTACCATCAGATGCTGGGGTTCGGCTG
GGCGGGAATATTCCGGCGTTATCTTGTTGAGCCGGCGTCTATGTGGTGGCCATCCAACCT
AGTGCAGGTCTCTCTGTTCAGGTACACTGCTTGAAAACCAGAGTAGATAGTATGACAAAA
AATCTTCTCACCAGAGTTGAATTCTTGCAAAATTTTGATCCACTCAAACCTCCACACCGG
CAATGCAAGAGTCTGAACCACCACATATGTTCCACTTGGAAGTTGGAACCGCTGCAGTGC
TGCACCGAACTACAACAAAAATGGAAGAAGAAAAGTGACATAGTTAGGAGCTGAGGGACC
TCTTATATATTTTCTCTATTATTTTTTCAAGAAGCTTCCCTAGCTAAGAATGACAGGACA
AACACAAACCAAATTCTGTTTGAGTATAGTAAGAAATCCAAGATTTAAACATATGTAAAA
CTAAAACTAAAATGGAGTTGTGCATATACACATTCTTAGCTCTGAAACGACAAAGAAGTT
TGCATTTGCATTCCGTAAGAAAATAACTTACATATTTCTTATACTAGCGCACTTCATGAG
AAGGAAGCACGGAGAAAAGGTGGCTTGACGCGGAACCAGTTCTTCCTGGTGGCATTCGTC
TGCAGCTTTGCATACTACATCTTCCCAGGCTACCTATTCCAGATGCTCACCTCCCTCTCC
TGGATCTGCTGGGTCTTCCCCAGCTCTGTCCTTGCCCAACAGCTTGGTTCAGGTCTCCGA
GGCCTCGGCGTTGGTGCAATCGGTCTCGACTGGTCATCTATCTCCTCCTACCTTGGGAGC
CCTCTTGCTAGCCCATGGTTTGCCACTGTAAATGTTGGTGTTGGCTTCTTCATCGTCATG
TACATAATCACACCAATTGCATACTGGTTTAATTTCTACAAGGCACAAAATTTCCCCATA
TTTTCTGATGGCCTCTTCACCTCGACTGGGCAAAAATACAATGTATCAAGCATTGTTGAC
TCCCATTTCCATTTTGACACCAAGGCCTATGAGAAGAATGGGCCACTATACCTCAGTACT
TCCCTTCTTGTCACATACGGTGTTGGTTTTGCAACCCTTGCTGCAACAATTGTTCATGCT
CTCCTCTTCCATGGAAGGTATTTTTTTTTCTTAGATTCGCCACTCCACTGTCTACAATAT
TAAAATAATGTGGTTAAGAACCATGATACTTGTCTCCAGTGAAATTTGGCTATTAAGTAA
ATCAGCTTTTCAAGAAAAAAGGATGGACATACACACGAAACTTATGAGGAGATATAAACA
GGTCCCTGAGTGGTGGTTCATATGCATCCTTATTGCTAACATCGGAACGACCATATTTGC
TTGTGAATACTACAATGAGGAACTCCAATTGCCCTGGTGGGGTGTTTTGTTTGCATGCTC
CATTGCCTTTTTCTTCACCCTCCCAATAGGGATAATCAAAGCAACAACAAATCAGGTATG
TGGATTTAACACATTGTGCATATTATGTCATACAGATCTAACCAGTTCAGCCTTTTTCAT
TATATACAGACTCCAGGCCTGAATGTCATCACGGAGTACATTATTGGGTATCTGTACCCT
GGACGACCCGTTGCAAATATGTGCTTCAAGGTATATGGTTACATCAGCATGAAACAAGCT
TTGGCATTTCTTGAAGATTTTAAGCTGGGTCACTACATGAAGATTCCACCGAGGACAATG
TTTATGGCTCAGGTGGTGGGAACTTCAATTGCAGCATTTGTGTATATTGGCACAGCATGG
TGGCTAATGGAGACAATCCCCAACATCTGCAACACTGAGCTCCTCCCGTCAGATAGCCCT
TGGACCTGCCCAGGTGACCATGTATTCTATGATGCATCAGTCACATGGGGACTTATTAGC
CCGCGCAGGATATTTGGGGACTTAGGCACTTATTCAGCTCTAAATTGGTTCTTTTTGTGT
GGAGCTATTGCCCCTCTACTTGTCTGGTTTGCACACAAGACATTCCCAGGCCAGAACTGG
ATCTTACTCATCAAGACGCCTGTACTAATTGGTGCCACCTTCCAGATGCCTCCTGCTACT
GCCGTCAACTACACGACTTGGATACTTGTTGGGTTCTTGTCAGGTTATGTGGTCTATAGA
TATCGACGTGATTGGTGGGAGAGACACAATTATCTGCTTTCAGGTGCACTGGATGCTGGT
TTGGCTTTCATGGCGGTCTTAATTTACTTGTGCTTAGGCTTGGAGGACATCAGTCTGAAC
TGGTGGGGAAATGACTTGGATGGGTGTCCTTTGGCTTCTTGTCCCACTGCTAAAGGTATA
GTTGTCAAGGGATGTGCAGTCTATACTTGAGGATCTCCTATTGCTTCTTGTCCCACTGCT
ACAGTGTTACCCAGACCTCCATGGGTGCAAGCCAATATGATTAGATCTAATTTGACCCTT
GTCATCTATAAACATCAGTAGAACCAGCTTTGATTCATAGCTGGAAATTAGCAATGTAGT
TTCAGGGTTAGTGGTCATAACTTGTATCCTATCAGTATTCTCGAAAAAACTTGTATCCTA
CCAAACAAGTTAAATTTTGATCTCTG

CDS

717 bp

>Os06t0125500-01 Similar to Oligopeptide transporter 9.
GAACTGAGAAGGCTCGCAGCACACACAACCATGATGCTCCACCACGAAGCAAGTGTGCAA
CAAGCGCGAGAGGAAGAAGAAGAGCTTGATCACCATGGCGATCCGATGATCACCTCCCCT
CTCTTGCGACCATCGACGTCGGGCAGCTCGCCGGAGAATGGAGAGGAGGAGAACTCACCG
GTGGAGCTGGTGGCGCTGACGGTGCCAGTGAGCGACGAGCCGGAGACGCCGGTGCTGACG
TTCAGGATGTGGGTGCTGGGGACGGCGTCGTGCGCGGTGCTCTCCTTCCTTAACCAGTTC
TTCTGGTACCGCAAGGAGCCGCTCACCATCACCGCCATCTCCGCGCAGATCGCCGTCGTG
CCGCTCGGCCGCCTCATGGCGGCGACGCTGCCGGAGCACGCCTTCTTCCGTGGCCGGCCG
TGGGAGTTCACGCTTAATCCGGGGCCGTTCAATGTCAAGGAGCACGTGCTCATCACCATC
TTCGCCAACTCCGGCGCCGGCACCGTCTATGCCATCCACGTCATCACCGGCGTCCGTGTC
TTCTACGGGAAAACCCTCTCCTTCTTCATCTCCCTCCTTGTCGTCCTCACAACACAGTAC
CATCAGATGCTGGGGTTCGGCTGGGCGGGAATATTCCGGCGTTATCTTGTTGAGCCGGCG
TCTATGTGGTGGCCATCCAACCTAGTGCAGGTCTCTCTGTTCAGGTACACTGCTTGA

Protein

239 aa

>Os06t0125500-01 Similar to Oligopeptide transporter 9.
ELRRLAAHTTMMLHHEASVQQAREEEEELDHHGDPMITSPLLRPSTSGSSPENGEEENSP
VELVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAISAQIAVV
PLGRLMAATLPEHAFFRGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITGVRV
FYGKTLSFFISLLVVLTTQYHQMLGFGWAGIFRRYLVEPASMWWPSNLVQVSLFRYTA*

5'UTR

chr06:1375402..1375438 (- strand) : 37 bp

CDS

chr06:1375278..1375401 (- strand) : 124 bp

chr06:1374663..1375135 (- strand) : 473 bp

chr06:1374409..1374528 (- strand) : 120 bp

3'UTR

chr06:1372811..1374408 (- strand) : 1598 bp

chr06:1371852..1372705 (- strand) : 854 bp

FASTA

>Os06t0125500-01 class=Sequence position=chr06:1371852..1375438 (- strand)
ATTGACGAAC CGGAGGAACC AAAACGACCA CGCGTGAGAA CTGAGAAGGC TCGCAGCACA CACAACCATG ATGCTCCACC
ACGAAGCAAG TGTGCAACAA GCGCGAGAGG AAGAAGAAGA GCTTGATCAC CATGGCGATC CGATGATCAC CTCCCCTCTC
TGTGAGCACC CAGAACCCAG AAGCAAGATC ATATATTGTT ATTTCATTTT CCTTTTTTTA ACGAATAAGA TCAACGAGAT
TATATATATA TATATATGGC CTTCATCGTA TATATGTTGC TGACTGATGA TGCTCGTGCA CAGTGCGACC ATCGACGTCG
GGCAGCTCGC CGGAGAATGG AGAGGAGGAG AACTCACCGG TGGAGCTGGT GGCGCTGACG GTGCCAGTGA GCGACGAGCC
GGAGACGCCG GTGCTGACGT TCAGGATGTG GGTGCTGGGG ACGGCGTCGT GCGCGGTGCT CTCCTTCCTT AACCAGTTCT
TCTGGTACCG CAAGGAGCCG CTCACCATCA CCGCCATCTC CGCGCAGATC GCCGTCGTGC CGCTCGGCCG CCTCATGGCG
GCGACGCTGC CGGAGCACGC CTTCTTCCGT GGCCGGCCGT GGGAGTTCAC GCTTAATCCG GGGCCGTTCA ATGTCAAGGA
GCACGTGCTC ATCACCATCT TCGCCAACTC CGGCGCCGGC ACCGTCTATG CCATCCACGT CATCACCGGC GTCCGTGTCT
TCTACGGGAA AACCCTCTCC TTCTTCATCT CCCTCCTTGT CGTCCTCACA ACACAGGTGC ATGCAAACTA GCTTCTGCCT
AAACATTTAA TAAATTAAGT TGTCAACGCC CTGATGCTAG ATTAGCTTAA TTACCTGGCA ATCAAAAATA GAAAAAAATA
TTTCTTCCTT CTCATGCGTG TACGATACAG TACCATCAGA TGCTGGGGTT CGGCTGGGCG GGAATATTCC GGCGTTATCT
TGTTGAGCCG GCGTCTATGT GGTGGCCATC CAACCTAGTG CAGGTCTCTC TGTTCAGGTA CACTGCTTGA AAACCAGAGT
AGATAGTATG ACAAAAAATC TTCTCACCAG AGTTGAATTC TTGCAAAATT TTGATCCACT CAAACCTCCA CACCGGCAAT
GCAAGAGTCT GAACCACCAC ATATGTTCCA CTTGGAAGTT GGAACCGCTG CAGTGCTGCA CCGAACTACA ACAAAAATGG
AAGAAGAAAA GTGACATAGT TAGGAGCTGA GGGACCTCTT ATATATTTTC TCTATTATTT TTTCAAGAAG CTTCCCTAGC
TAAGAATGAC AGGACAAACA CAAACCAAAT TCTGTTTGAG TATAGTAAGA AATCCAAGAT TTAAACATAT GTAAAACTAA
AACTAAAATG GAGTTGTGCA TATACACATT CTTAGCTCTG AAACGACAAA GAAGTTTGCA TTTGCATTCC GTAAGAAAAT
AACTTACATA TTTCTTATAC TAGCGCACTT CATGAGAAGG AAGCACGGAG AAAAGGTGGC TTGACGCGGA ACCAGTTCTT
CCTGGTGGCA TTCGTCTGCA GCTTTGCATA CTACATCTTC CCAGGCTACC TATTCCAGAT GCTCACCTCC CTCTCCTGGA
TCTGCTGGGT CTTCCCCAGC TCTGTCCTTG CCCAACAGCT TGGTTCAGGT CTCCGAGGCC TCGGCGTTGG TGCAATCGGT
CTCGACTGGT CATCTATCTC CTCCTACCTT GGGAGCCCTC TTGCTAGCCC ATGGTTTGCC ACTGTAAATG TTGGTGTTGG
CTTCTTCATC GTCATGTACA TAATCACACC AATTGCATAC TGGTTTAATT TCTACAAGGC ACAAAATTTC CCCATATTTT
CTGATGGCCT CTTCACCTCG ACTGGGCAAA AATACAATGT ATCAAGCATT GTTGACTCCC ATTTCCATTT TGACACCAAG
GCCTATGAGA AGAATGGGCC ACTATACCTC AGTACTTCCC TTCTTGTCAC ATACGGTGTT GGTTTTGCAA CCCTTGCTGC
AACAATTGTT CATGCTCTCC TCTTCCATGG AAGGTATTTT TTTTTCTTAG ATTCGCCACT CCACTGTCTA CAATATTAAA
ATAATGTGGT TAAGAACCAT GATACTTGTC TCCAGTGAAA TTTGGCTATT AAGTAAATCA GCTTTTCAAG AAAAAAGGAT
GGACATACAC ACGAAACTTA TGAGGAGATA TAAACAGGTC CCTGAGTGGT GGTTCATATG CATCCTTATT GCTAACATCG
GAACGACCAT ATTTGCTTGT GAATACTACA ATGAGGAACT CCAATTGCCC TGGTGGGGTG TTTTGTTTGC ATGCTCCATT
GCCTTTTTCT TCACCCTCCC AATAGGGATA ATCAAAGCAA CAACAAATCA GGTATGTGGA TTTAACACAT TGTGCATATT
ATGTCATACA GATCTAACCA GTTCAGCCTT TTTCATTATA TACAGACTCC AGGCCTGAAT GTCATCACGG AGTACATTAT
TGGGTATCTG TACCCTGGAC GACCCGTTGC AAATATGTGC TTCAAGGTAT ATGGTTACAT CAGCATGAAA CAAGCTTTGG
CATTTCTTGA AGATTTTAAG CTGGGTCACT ACATGAAGAT TCCACCGAGG ACAATGTTTA TGGCTCAGGT AAGTTCTATT
AGCCCTATAA TGACTTATGT ATCATTTCTC CTAAAGAGTA GACATTTGGT TCTATTGTAT CGTGTGATTT ACAAACTTCT
CCAAACATGA CAGGTGGTGG GAACTTCAAT TGCAGCATTT GTGTATATTG GCACAGCATG GTGGCTAATG GAGACAATCC
CCAACATCTG CAACACTGAG CTCCTCCCGT CAGATAGCCC TTGGACCTGC CCAGGTGACC ATGTATTCTA TGATGCATCA
GTCACATGGG GACTTATTAG CCCGCGCAGG ATATTTGGGG ACTTAGGCAC TTATTCAGCT CTAAATTGGT TCTTTTTGTG
TGGAGCTATT GCCCCTCTAC TTGTCTGGTT TGCACACAAG ACATTCCCAG GCCAGAACTG GATCTTACTC ATCAAGACGC
CTGTACTAAT TGGTGCCACC TTCCAGATGC CTCCTGCTAC TGCCGTCAAC TACACGACTT GGATACTTGT TGGGTTCTTG
TCAGGTTATG TGGTCTATAG ATATCGACGT GATTGGTGGG AGAGACACAA TTATCTGCTT TCAGGTGCAC TGGATGCTGG
TTTGGCTTTC ATGGCGGTCT TAATTTACTT GTGCTTAGGC TTGGAGGACA TCAGTCTGAA CTGGTGGGGA AATGACTTGG
ATGGGTGTCC TTTGGCTTCT TGTCCCACTG CTAAAGGTAT AGTTGTCAAG GGATGTGCAG TCTATACTTG AGGATCTCCT
ATTGCTTCTT GTCCCACTGC TACAGTGTTA CCCAGACCTC CATGGGTGCA AGCCAATATG ATTAGATCTA ATTTGACCCT
TGTCATCTAT AAACATCAGT AGAACCAGCT TTGATTCATA GCTGGAAATT AGCAATGTAG TTTCAGGGTT AGTGGTCATA
ACTTGTATCC TATCAGTATT CTCGAAAAAA CTTGTATCCT ACCAAACAAG TTAAATTTTG ATCTCTG

Locus: Os06g0125500

Loading...

Locus: Os06g0125500

Loading...