Os06t0125500-02

Locus

Os06g0125500

Description

Similar to Oligopeptide transporter 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT3, OsGT1

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 3, glutathione transporter 1

Transcript Evidence

AK067671 (DDBJ, Best hit)

Protein Evidence

B6SVF4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J013116J20 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0125500-02)

RiceXPro (AK067671)

Others

Oryzabase (12496)

KEGG (Os06t0125500-02)

Transcript

2377 bp

>Os06t0125500-02 Similar to Oligopeptide transporter 9.
GCTGACTGATGATGCTCGTGCACAGTGCGACCATCGACGTCGGGCAGCTCGCCGGAGAAT
GGAGAGGAGGAGAACTCACCGGTGGAGCTGGTGGCGCTGACGGTGCCAGTGAGCGACGAG
CCGGAGACGCCGGTGCTGACGTTCAGGATGTGGGTGCTGGGGACGGCGTCGTGCGCGGTG
CTCTCCTTCCTTAACCAGTTCTTCTGGTACCGCAAGGAGCCGCTCACCATCACCGCCATC
TCCGCGCAGATCGCCGTCGTGCCGCTCGGCCGCCTCATGGCGGCGACGCTGCCGGAGCAC
GCCTTCTTCCGTGGCCGGCCGTGGGAGTTCACGCTTAATCCGGGGCCGTTCAATGTCAAG
GAGCACGTGCTCATCACCATCTTCGCCAACTCCGGCGCCGGCACCGTCTATGCCATCCAC
GTCATCACCGGCGTCCGTGTCTTCTACGGGAAAACCCTCTCCTTCTTCATCTCCCTCCTT
GTCGTCCTCACAACACAGATGCTGGGGTTCGGCTGGGCGGGAATATTCCGGCGTTATCTT
GTTGAGCCGGCGTCTATGTGGTGGCCATCCAACCTAGTGCAGGTCTCTCTGTTCAGCGCA
CTTCATGAGAAGGAAGCACGGAGAAAAGGTGGCTTGACGCGGAACCAGTTCTTCCTGGTG
GCATTCGTCTGCAGCTTTGCATACTACATCTTCCCAGGCTACCTATTCCAGATGCTCACC
TCCCTCTCCTGGATCTGCTGGGTCTTCCCCAGCTCTGTCCTTGCCCAACAGCTTGGTTCA
GGTCTCCGAGGCCTCGGCGTTGGTGCAATCGGTCTCGACTGGTCATCTATCTCCTCCTAC
CTTGGGAGCCCTCTTGCTAGCCCATGGTTTGCCACTGTAAATGTTGGTGTTGGCTTCTTC
ATCGTCATGTACATAATCACACCAATTGCATACTGGTTTAATTTCTACAAGGCACAAAAT
TTCCCCATATTTTCTGATGGCCTCTTCACCTCGACTGGGCAAAAATACAATGTATCAAGC
ATTGTTGACTCCCATTTCCATTTTGACACCAAGGCCTATGAGAAGAATGGGCCACTATAC
CTCAGTACTTCCCTTCTTGTCACATACGGTGTTGGTTTTGCAACCCTTGCTGCAACAATT
GTTCATGCTCTCCTCTTCCATGGAAGGTCCCTGAGTGGTGGTTCATATGCATCCTTATTG
CTAACATCGGAACGACCATATTTGCTTGTGAATACTACAATGAGGAACTCCAATTGCCCT
GGTGGGGTGTTTTGTTTGCATGCTCCATTGCCTTTTTCTTCACCCTCCCAATAGGGATAA
TCAAAGCAACAACAAATCAGACTCCAGGCCTGAATGTCATCACGGAGTACATTATTGGGT
ATCTGTACCCTGGACGACCCGTTGCAAATATGTGCTTCAAGGTATATGGTTACATCAGCA
TGAAACAAGCTTTGGCATTTCTTGAAGATTTTAAGCTGGGTCACTACATGAAGATTCCAC
CGAGGACAATGTTTATGGCTCAGGTGGTGGGAACTTCAATTGCAGCATTTGTGTATATTG
GCACAGCATGGTGGCTAATGGAGACAATCCCCAACATCTGCAACACTGAGCTCCTCCCGT
CAGATAGCCCTTGGACCTGCCCAGGTGACCATGTATTCTATGATGCATCAGTCACATGGG
GACTTATTAGCCCGCGCAGGATATTTGGGGACTTAGGCACTTATTCAGCTCTAAATTGGT
TCTTTTTGTGTGGAGCTATTGCCCCTCTACTTGTCTGGTTTGCACACAAGACATTCCCAG
GCCAGAACTGGATCTTACTCATCAAGACGCCTGTACTAATTGGTGCCACCTTCCAGATGC
CTCCTGCTACTGCCGTCAACTACACGACTTGGATACTTGTTGGGTTCTTGTCAGGTTATG
TGGTCTATAGATATCGACGTGATTGGTGGGAGAGACACAATTATCTGCTTTCAGGTGCAC
TGGATGCTGGTTTGGCTTTCATGGCGGTCTTAATTTACTTGTGCTTAGGCTTGGAGGACA
TCAGTCTGAACTGGTGGGGAAATGACTTGGATGGGTGTCCTTTGGCTTCTTGTCCCACTG
CTAAAGGTATAGTTGTCAAGGGATGTGCAGTCTATACTTGAGGATCTCCTATTGCTTCTT
GTCCCACTGCTACAGTGTTACCCAGACCTCCATGGGTGCAAGCCAATATGATTAGATCTA
ATTTGACCCTTGTCATCTATAAACATCAGTAGAACCAGCTTTGATTCATAGCTGGAAATT
AGCAATGTAGTTTCAGGGTTAGTGGTCATAACTTGTATCCTATCAGTATTCTCGAAAAAA
CTTGTATCCTACCAAACAAGTTAAATTTTGATCTCTG

CDS

1302 bp

>Os06t0125500-02 Similar to Oligopeptide transporter 9.
TGCTCGTGCACAGTGCGACCATCGACGTCGGGCAGCTCGCCGGAGAATGGAGAGGAGGAG
AACTCACCGGTGGAGCTGGTGGCGCTGACGGTGCCAGTGAGCGACGAGCCGGAGACGCCG
GTGCTGACGTTCAGGATGTGGGTGCTGGGGACGGCGTCGTGCGCGGTGCTCTCCTTCCTT
AACCAGTTCTTCTGGTACCGCAAGGAGCCGCTCACCATCACCGCCATCTCCGCGCAGATC
GCCGTCGTGCCGCTCGGCCGCCTCATGGCGGCGACGCTGCCGGAGCACGCCTTCTTCCGT
GGCCGGCCGTGGGAGTTCACGCTTAATCCGGGGCCGTTCAATGTCAAGGAGCACGTGCTC
ATCACCATCTTCGCCAACTCCGGCGCCGGCACCGTCTATGCCATCCACGTCATCACCGGC
GTCCGTGTCTTCTACGGGAAAACCCTCTCCTTCTTCATCTCCCTCCTTGTCGTCCTCACA
ACACAGATGCTGGGGTTCGGCTGGGCGGGAATATTCCGGCGTTATCTTGTTGAGCCGGCG
TCTATGTGGTGGCCATCCAACCTAGTGCAGGTCTCTCTGTTCAGCGCACTTCATGAGAAG
GAAGCACGGAGAAAAGGTGGCTTGACGCGGAACCAGTTCTTCCTGGTGGCATTCGTCTGC
AGCTTTGCATACTACATCTTCCCAGGCTACCTATTCCAGATGCTCACCTCCCTCTCCTGG
ATCTGCTGGGTCTTCCCCAGCTCTGTCCTTGCCCAACAGCTTGGTTCAGGTCTCCGAGGC
CTCGGCGTTGGTGCAATCGGTCTCGACTGGTCATCTATCTCCTCCTACCTTGGGAGCCCT
CTTGCTAGCCCATGGTTTGCCACTGTAAATGTTGGTGTTGGCTTCTTCATCGTCATGTAC
ATAATCACACCAATTGCATACTGGTTTAATTTCTACAAGGCACAAAATTTCCCCATATTT
TCTGATGGCCTCTTCACCTCGACTGGGCAAAAATACAATGTATCAAGCATTGTTGACTCC
CATTTCCATTTTGACACCAAGGCCTATGAGAAGAATGGGCCACTATACCTCAGTACTTCC
CTTCTTGTCACATACGGTGTTGGTTTTGCAACCCTTGCTGCAACAATTGTTCATGCTCTC
CTCTTCCATGGAAGGTCCCTGAGTGGTGGTTCATATGCATCCTTATTGCTAACATCGGAA
CGACCATATTTGCTTGTGAATACTACAATGAGGAACTCCAATTGCCCTGGTGGGGTGTTT
TGTTTGCATGCTCCATTGCCTTTTTCTTCACCCTCCCAATAG

Protein

434 aa

>Os06t0125500-02 Similar to Oligopeptide transporter 9.
CSCTVRPSTSGSSPENGEEENSPVELVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFL
NQFFWYRKEPLTITAISAQIAVVPLGRLMAATLPEHAFFRGRPWEFTLNPGPFNVKEHVL
ITIFANSGAGTVYAIHVITGVRVFYGKTLSFFISLLVVLTTQMLGFGWAGIFRRYLVEPA
SMWWPSNLVQVSLFSALHEKEARRKGGLTRNQFFLVAFVCSFAYYIFPGYLFQMLTSLSW
ICWVFPSSVLAQQLGSGLRGLGVGAIGLDWSSISSYLGSPLASPWFATVNVGVGFFIVMY
IITPIAYWFNFYKAQNFPIFSDGLFTSTGQKYNVSSIVDSHFHFDTKAYEKNGPLYLSTS
LLVTYGVGFATLAATIVHALLFHGRSLSGGSYASLLLTSERPYLLVNTTMRNSNCPGGVF
CLHAPLPFSSPSQ*

5'UTR

chr06:1375149..1375160 (- strand) : 12 bp

CDS

chr06:1374663..1375148 (- strand) : 486 bp

chr06:1374422..1374519 (- strand) : 98 bp

chr06:1373406..1373975 (- strand) : 570 bp

chr06:1373094..1373241 (- strand) : 148 bp

3'UTR

chr06:1373068..1373093 (- strand) : 26 bp

chr06:1372811..1372993 (- strand) : 183 bp

chr06:1371852..1372705 (- strand) : 854 bp

FASTA

>Os06t0125500-02 class=Sequence position=chr06:1371852..1375160 (- strand)
GCTGACTGAT GATGCTCGTG CACAGTGCGA CCATCGACGT CGGGCAGCTC GCCGGAGAAT GGAGAGGAGG AGAACTCACC
GGTGGAGCTG GTGGCGCTGA CGGTGCCAGT GAGCGACGAG CCGGAGACGC CGGTGCTGAC GTTCAGGATG TGGGTGCTGG
GGACGGCGTC GTGCGCGGTG CTCTCCTTCC TTAACCAGTT CTTCTGGTAC CGCAAGGAGC CGCTCACCAT CACCGCCATC
TCCGCGCAGA TCGCCGTCGT GCCGCTCGGC CGCCTCATGG CGGCGACGCT GCCGGAGCAC GCCTTCTTCC GTGGCCGGCC
GTGGGAGTTC ACGCTTAATC CGGGGCCGTT CAATGTCAAG GAGCACGTGC TCATCACCAT CTTCGCCAAC TCCGGCGCCG
GCACCGTCTA TGCCATCCAC GTCATCACCG GCGTCCGTGT CTTCTACGGG AAAACCCTCT CCTTCTTCAT CTCCCTCCTT
GTCGTCCTCA CAACACAGGT GCATGCAAAC TAGCTTCTGC CTAAACATTT AATAAATTAA GTTGTCAACG CCCTGATGCT
AGATTAGCTT AATTACCTGG CAATCAAAAA TAGAAAAAAA TATTTCTTCC TTCTCATGCG TGTACGATAC AGTACCATCA
GATGCTGGGG TTCGGCTGGG CGGGAATATT CCGGCGTTAT CTTGTTGAGC CGGCGTCTAT GTGGTGGCCA TCCAACCTAG
TGCAGGTCTC TCTGTTCAGG TACACTGCTT GAAAACCAGA GTAGATAGTA TGACAAAAAA TCTTCTCACC AGAGTTGAAT
TCTTGCAAAA TTTTGATCCA CTCAAACCTC CACACCGGCA ATGCAAGAGT CTGAACCACC ACATATGTTC CACTTGGAAG
TTGGAACCGC TGCAGTGCTG CACCGAACTA CAACAAAAAT GGAAGAAGAA AAGTGACATA GTTAGGAGCT GAGGGACCTC
TTATATATTT TCTCTATTAT TTTTTCAAGA AGCTTCCCTA GCTAAGAATG ACAGGACAAA CACAAACCAA ATTCTGTTTG
AGTATAGTAA GAAATCCAAG ATTTAAACAT ATGTAAAACT AAAACTAAAA TGGAGTTGTG CATATACACA TTCTTAGCTC
TGAAACGACA AAGAAGTTTG CATTTGCATT CCGTAAGAAA ATAACTTACA TATTTCTTAT ACTAGCGCAC TTCATGAGAA
GGAAGCACGG AGAAAAGGTG GCTTGACGCG GAACCAGTTC TTCCTGGTGG CATTCGTCTG CAGCTTTGCA TACTACATCT
TCCCAGGCTA CCTATTCCAG ATGCTCACCT CCCTCTCCTG GATCTGCTGG GTCTTCCCCA GCTCTGTCCT TGCCCAACAG
CTTGGTTCAG GTCTCCGAGG CCTCGGCGTT GGTGCAATCG GTCTCGACTG GTCATCTATC TCCTCCTACC TTGGGAGCCC
TCTTGCTAGC CCATGGTTTG CCACTGTAAA TGTTGGTGTT GGCTTCTTCA TCGTCATGTA CATAATCACA CCAATTGCAT
ACTGGTTTAA TTTCTACAAG GCACAAAATT TCCCCATATT TTCTGATGGC CTCTTCACCT CGACTGGGCA AAAATACAAT
GTATCAAGCA TTGTTGACTC CCATTTCCAT TTTGACACCA AGGCCTATGA GAAGAATGGG CCACTATACC TCAGTACTTC
CCTTCTTGTC ACATACGGTG TTGGTTTTGC AACCCTTGCT GCAACAATTG TTCATGCTCT CCTCTTCCAT GGAAGGTATT
TTTTTTTCTT AGATTCGCCA CTCCACTGTC TACAATATTA AAATAATGTG GTTAAGAACC ATGATACTTG TCTCCAGTGA
AATTTGGCTA TTAAGTAAAT CAGCTTTTCA AGAAAAAAGG ATGGACATAC ACACGAAACT TATGAGGAGA TATAAACAGG
TCCCTGAGTG GTGGTTCATA TGCATCCTTA TTGCTAACAT CGGAACGACC ATATTTGCTT GTGAATACTA CAATGAGGAA
CTCCAATTGC CCTGGTGGGG TGTTTTGTTT GCATGCTCCA TTGCCTTTTT CTTCACCCTC CCAATAGGGA TAATCAAAGC
AACAACAAAT CAGGTATGTG GATTTAACAC ATTGTGCATA TTATGTCATA CAGATCTAAC CAGTTCAGCC TTTTTCATTA
TATACAGACT CCAGGCCTGA ATGTCATCAC GGAGTACATT ATTGGGTATC TGTACCCTGG ACGACCCGTT GCAAATATGT
GCTTCAAGGT ATATGGTTAC ATCAGCATGA AACAAGCTTT GGCATTTCTT GAAGATTTTA AGCTGGGTCA CTACATGAAG
ATTCCACCGA GGACAATGTT TATGGCTCAG GTAAGTTCTA TTAGCCCTAT AATGACTTAT GTATCATTTC TCCTAAAGAG
TAGACATTTG GTTCTATTGT ATCGTGTGAT TTACAAACTT CTCCAAACAT GACAGGTGGT GGGAACTTCA ATTGCAGCAT
TTGTGTATAT TGGCACAGCA TGGTGGCTAA TGGAGACAAT CCCCAACATC TGCAACACTG AGCTCCTCCC GTCAGATAGC
CCTTGGACCT GCCCAGGTGA CCATGTATTC TATGATGCAT CAGTCACATG GGGACTTATT AGCCCGCGCA GGATATTTGG
GGACTTAGGC ACTTATTCAG CTCTAAATTG GTTCTTTTTG TGTGGAGCTA TTGCCCCTCT ACTTGTCTGG TTTGCACACA
AGACATTCCC AGGCCAGAAC TGGATCTTAC TCATCAAGAC GCCTGTACTA ATTGGTGCCA CCTTCCAGAT GCCTCCTGCT
ACTGCCGTCA ACTACACGAC TTGGATACTT GTTGGGTTCT TGTCAGGTTA TGTGGTCTAT AGATATCGAC GTGATTGGTG
GGAGAGACAC AATTATCTGC TTTCAGGTGC ACTGGATGCT GGTTTGGCTT TCATGGCGGT CTTAATTTAC TTGTGCTTAG
GCTTGGAGGA CATCAGTCTG AACTGGTGGG GAAATGACTT GGATGGGTGT CCTTTGGCTT CTTGTCCCAC TGCTAAAGGT
ATAGTTGTCA AGGGATGTGC AGTCTATACT TGAGGATCTC CTATTGCTTC TTGTCCCACT GCTACAGTGT TACCCAGACC
TCCATGGGTG CAAGCCAATA TGATTAGATC TAATTTGACC CTTGTCATCT ATAAACATCA GTAGAACCAG CTTTGATTCA
TAGCTGGAAA TTAGCAATGT AGTTTCAGGG TTAGTGGTCA TAACTTGTAT CCTATCAGTA TTCTCGAAAA AACTTGTATC
CTACCAAACA AGTTAAATTT TGATCTCTG

Locus: Os06g0125500

Loading...

Locus: Os06g0125500

Loading...