Os06t0125500-03

Locus

Os06g0125500

Description

Glutathione transporter, Transport of glutathione derivatives

RAP-DB Gene Symbol Synonym(s)

OsGT1, OsOPT3

RAP-DB Gene Name Synonym(s)

glutathione transporter 1, Oligopeptide transporter 3

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT3, OsGT1

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 3, glutathione transporter 1

Transcript Evidence

AF393848

Protein Evidence

Q7FU78

Literature

PMID: 14730075

Note

Manual Curation

May 2, 2014

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter, OPT superfamily (IPR004813)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Others

Oryzabase (12496)

Transcript

2567 bp

>Os06t0125500-03 Glutathione transporter, Transport of glutathione derivatives
GAACTGAGAAGGCTCGCAGCACACACAACCATGATGCTCCACCACGAAGCAAGTGTGCAA
CAAGCGCGAGAGGAAGAAGAAGAGCTTGATCACCATGGCGATCCGATGATCACCTCCCCT
CTCTTGCGACCATCGACGTCGGGCAGCTCGCCGGAGAATGGAGAGGAGGAGAACTCACCG
GTGGAGCTGGTGGCGCTGACGGTGCCAGTGAGCGACGAGCCGGAGACGCCGGTGCTGACG
TTCAGGATGTGGGTGCTGGGGACGGCGTCGTGCGCGGTGCTCTCCTTCCTTAACCAGTTC
TTCTGGTACCGCAAGGAGCCGCTCACCATCACCGCCATCTCCGCGCAGATCGCCGTCGTG
CCGCTCGGCCGCCTCATGGCGGCGACGCTGCCGGAGCACGCCTTCTTCCGTGGCCGGCCG
TGGGAGTTCACGCTTAATCCGGGGCCGTTCAATGTCAAGGAGCACGTGCTCATCACCATC
TTCGCCAACTCCGGCGCCGGCACCGTCTATGCCATCCACGTCATCACCGGCGTCCGTGTC
TTCTACGGGAAAACCCTCTCCTTCTTCATCTCCCTCCTTGTCGTCCTCACAACACAGTAC
CATCAGATGCTGGGGTTCGGCTGGGCGGGAATATTCCGGCGTTATCTTGTTGAGCCGGCG
TCTATGTGGTGGCCATCCAACCTAGTGCAGGTCTCTCTGTTCAGCGCACTTCATGAGAAG
GAAGCACGGAGAAAAGGTGGCTTGACGCGGAACCAGTTCTTCCTGGTGGCATTCGTCTGC
AGCTTTGCATACTACATCTTCCCAGGCTACCTATTCCAGATGCTCACCTCCCTCTCCTGG
ATCTGCTGGGTCTTCCCCAGCTCTGTCCTTGCCCAACAGCTTGGTTCAGGTCTCCGAGGC
CTCGGCGTTGGTGCAATCGGTCTCGACTGGTCATCTATCTCCTCCTACCTTGGGAGCCCT
CTTGCTAGCCCATGGTTTGCCACTGTAAATGTTGGTGTTGGCTTCTTCATCGTCATGTAC
ATAATCACACCAATTGCATACTGGTTTAATTTCTACAAGGCACAAAATTTCCCCATATTT
TCTGATGGCCTCTTCACCTCGACTGGGCAAAAATACAATGTATCAAGCATTGTTGACTCC
CATTTCCATTTTGACACCAAGGCCTATGAGAAGAATGGGCCACTATACCTCAGTACTTCC
CTTCTTGTCACATACGGTGTTGGTTTTGCAACCCTTGCTGCAACAATTGTTCATGCTCTC
CTCTTCCATGGAAGTGAAATTTGGCTATTAAGTAAATCAGCTTTTCAAGAAAAAAGGATG
GACATACACACGAAACTTATGAGGAGATATAAACAGGTCCCTGAGTGGTGGTTCATATGC
ATCCTTATTGCTAACATCGGAACGACCATATTTGCTTGTGAATACTACAATGAGGAACTC
CAATTGCCCTGGTGGGGTGTTTTGTTTGCATGCTCCATTGCCTTTTTCTTCACCCTCCCA
ATAGGGATAATCAAAGCAACAACAAATCAGACTCCAGGCCTGAATGTCATCACGGAGTAC
ATTATTGGGTATCTGTACCCTGGACGACCCGTTGCAAATATGTGCTTCAAGGTATATGGT
TACATCAGCATGAAACAAGCTTTGGCATTTCTTGAAGATTTTAAGCTGGGTCACTACATG
AAGATTCCACCGAGGACAATGTTTATGGCTCAGGTGGTGGGAACTTCAATTGCAGCATTT
GTGTATATTGGCACAGCATGGTGGCTAATGGAGACAATCCCCAACATCTGCAACACTGAG
CTCCTCCCGTCAGATAGCCCTTGGACCTGCCCAGGTGACCATGTATTCTATGATGCATCA
GTCACATGGGGACTTATTAGCCCGCGCAGGATATTTGGGGACTTAGGCACTTATTCAGCT
CTAAATTGGTTCTTTTTGTGTGGAGCTATTGCCCCTCTACTTGTCTGGTTTGCACACAAG
ACATTCCCAGGCCAGAACTGGATCTTACTCATCAAGACGCCTGTACTAATTGGTGCCACC
TTCCAGATGCCTCCTGCTACTGCCGTCAACTACACGACTTGGATACTTGTTGGGTTCTTG
TCAGGTTATGTGGTCTATAGATATCGACGTGATTGGTGGGAGAGACACAATTATCTGCTT
TCAGGTGCACTGGATGCTGGTTTGGCTTTCATGGCGGTCTTAATTTACTTGTGCTTAGGC
TTGGAGGACATCAGTCTGAACTGGTGGGGAAATGACTTGGATGGGTGTCCTTTGGCTTCT
TGTCCCACTGCTAAAGGTATAGTTGTCAAGGGATGTGCAGTCTATACTTGAGGATCTCCT
ATTGCTTCTTGTCCCACTGCTACAGTGTTACCCAGACCTCCATGGGTGCAAGCCAATATG
ATTAGATCTAATTTGACCCTTGTCATCTATAAACATCAGTAGAACCAGCTTTGATTCATA
GCTGGAAATTAGCAATGTAGTTTCAGGGTTAGTGGTCATAACTTGTATCCTATCAGTATT
CTCGAAAAAACTTGTATCCTACCAAACAAGTTAAATTTTGATCTCTG

CDS

2301 bp

>Os06t0125500-03 Glutathione transporter, Transport of glutathione derivatives
ATGATGCTCCACCACGAAGCAAGTGTGCAACAAGCGCGAGAGGAAGAAGAAGAGCTTGAT
CACCATGGCGATCCGATGATCACCTCCCCTCTCTTGCGACCATCGACGTCGGGCAGCTCG
CCGGAGAATGGAGAGGAGGAGAACTCACCGGTGGAGCTGGTGGCGCTGACGGTGCCAGTG
AGCGACGAGCCGGAGACGCCGGTGCTGACGTTCAGGATGTGGGTGCTGGGGACGGCGTCG
TGCGCGGTGCTCTCCTTCCTTAACCAGTTCTTCTGGTACCGCAAGGAGCCGCTCACCATC
ACCGCCATCTCCGCGCAGATCGCCGTCGTGCCGCTCGGCCGCCTCATGGCGGCGACGCTG
CCGGAGCACGCCTTCTTCCGTGGCCGGCCGTGGGAGTTCACGCTTAATCCGGGGCCGTTC
AATGTCAAGGAGCACGTGCTCATCACCATCTTCGCCAACTCCGGCGCCGGCACCGTCTAT
GCCATCCACGTCATCACCGGCGTCCGTGTCTTCTACGGGAAAACCCTCTCCTTCTTCATC
TCCCTCCTTGTCGTCCTCACAACACAGTACCATCAGATGCTGGGGTTCGGCTGGGCGGGA
ATATTCCGGCGTTATCTTGTTGAGCCGGCGTCTATGTGGTGGCCATCCAACCTAGTGCAG
GTCTCTCTGTTCAGCGCACTTCATGAGAAGGAAGCACGGAGAAAAGGTGGCTTGACGCGG
AACCAGTTCTTCCTGGTGGCATTCGTCTGCAGCTTTGCATACTACATCTTCCCAGGCTAC
CTATTCCAGATGCTCACCTCCCTCTCCTGGATCTGCTGGGTCTTCCCCAGCTCTGTCCTT
GCCCAACAGCTTGGTTCAGGTCTCCGAGGCCTCGGCGTTGGTGCAATCGGTCTCGACTGG
TCATCTATCTCCTCCTACCTTGGGAGCCCTCTTGCTAGCCCATGGTTTGCCACTGTAAAT
GTTGGTGTTGGCTTCTTCATCGTCATGTACATAATCACACCAATTGCATACTGGTTTAAT
TTCTACAAGGCACAAAATTTCCCCATATTTTCTGATGGCCTCTTCACCTCGACTGGGCAA
AAATACAATGTATCAAGCATTGTTGACTCCCATTTCCATTTTGACACCAAGGCCTATGAG
AAGAATGGGCCACTATACCTCAGTACTTCCCTTCTTGTCACATACGGTGTTGGTTTTGCA
ACCCTTGCTGCAACAATTGTTCATGCTCTCCTCTTCCATGGAAGTGAAATTTGGCTATTA
AGTAAATCAGCTTTTCAAGAAAAAAGGATGGACATACACACGAAACTTATGAGGAGATAT
AAACAGGTCCCTGAGTGGTGGTTCATATGCATCCTTATTGCTAACATCGGAACGACCATA
TTTGCTTGTGAATACTACAATGAGGAACTCCAATTGCCCTGGTGGGGTGTTTTGTTTGCA
TGCTCCATTGCCTTTTTCTTCACCCTCCCAATAGGGATAATCAAAGCAACAACAAATCAG
ACTCCAGGCCTGAATGTCATCACGGAGTACATTATTGGGTATCTGTACCCTGGACGACCC
GTTGCAAATATGTGCTTCAAGGTATATGGTTACATCAGCATGAAACAAGCTTTGGCATTT
CTTGAAGATTTTAAGCTGGGTCACTACATGAAGATTCCACCGAGGACAATGTTTATGGCT
CAGGTGGTGGGAACTTCAATTGCAGCATTTGTGTATATTGGCACAGCATGGTGGCTAATG
GAGACAATCCCCAACATCTGCAACACTGAGCTCCTCCCGTCAGATAGCCCTTGGACCTGC
CCAGGTGACCATGTATTCTATGATGCATCAGTCACATGGGGACTTATTAGCCCGCGCAGG
ATATTTGGGGACTTAGGCACTTATTCAGCTCTAAATTGGTTCTTTTTGTGTGGAGCTATT
GCCCCTCTACTTGTCTGGTTTGCACACAAGACATTCCCAGGCCAGAACTGGATCTTACTC
ATCAAGACGCCTGTACTAATTGGTGCCACCTTCCAGATGCCTCCTGCTACTGCCGTCAAC
TACACGACTTGGATACTTGTTGGGTTCTTGTCAGGTTATGTGGTCTATAGATATCGACGT
GATTGGTGGGAGAGACACAATTATCTGCTTTCAGGTGCACTGGATGCTGGTTTGGCTTTC
ATGGCGGTCTTAATTTACTTGTGCTTAGGCTTGGAGGACATCAGTCTGAACTGGTGGGGA
AATGACTTGGATGGGTGTCCTTTGGCTTCTTGTCCCACTGCTAAAGGTATAGTTGTCAAG
GGATGTGCAGTCTATACTTGA

Protein

767 aa

>Os06t0125500-03 Glutathione transporter, Transport of glutathione derivatives
MMLHHEASVQQAREEEEELDHHGDPMITSPLLRPSTSGSSPENGEEENSPVELVALTVPV
SDEPETPVLTFRMWVLGTASCAVLSFLNQFFWYRKEPLTITAISAQIAVVPLGRLMAATL
PEHAFFRGRPWEFTLNPGPFNVKEHVLITIFANSGAGTVYAIHVITGVRVFYGKTLSFFI
SLLVVLTTQYHQMLGFGWAGIFRRYLVEPASMWWPSNLVQVSLFSALHEKEARRKGGLTR
NQFFLVAFVCSFAYYIFPGYLFQMLTSLSWICWVFPSSVLAQQLGSGLRGLGVGAIGLDW
SSISSYLGSPLASPWFATVNVGVGFFIVMYIITPIAYWFNFYKAQNFPIFSDGLFTSTGQ
KYNVSSIVDSHFHFDTKAYEKNGPLYLSTSLLVTYGVGFATLAATIVHALLFHGSEIWLL
SKSAFQEKRMDIHTKLMRRYKQVPEWWFICILIANIGTTIFACEYYNEELQLPWWGVLFA
CSIAFFFTLPIGIIKATTNQTPGLNVITEYIIGYLYPGRPVANMCFKVYGYISMKQALAF
LEDFKLGHYMKIPPRTMFMAQVVGTSIAAFVYIGTAWWLMETIPNICNTELLPSDSPWTC
PGDHVFYDASVTWGLISPRRIFGDLGTYSALNWFFLCGAIAPLLVWFAHKTFPGQNWILL
IKTPVLIGATFQMPPATAVNYTTWILVGFLSGYVVYRYRRDWWERHNYLLSGALDAGLAF
MAVLIYLCLGLEDISLNWWGNDLDGCPLASCPTAKGIVVKGCAVYT*

5'UTR

chr06:1375372..1375401 (- strand) : 30 bp

CDS

chr06:1375278..1375371 (- strand) : 94 bp

chr06:1374663..1375135 (- strand) : 473 bp

chr06:1374422..1374528 (- strand) : 107 bp

chr06:1373406..1373975 (- strand) : 570 bp

chr06:1373068..1373323 (- strand) : 256 bp

chr06:1372811..1372993 (- strand) : 183 bp

chr06:1372088..1372705 (- strand) : 618 bp

3'UTR

chr06:1371852..1372087 (- strand) : 236 bp

FASTA

>Os06t0125500-03 class=Sequence position=chr06:1371852..1375401 (- strand)
GAACTGAGAA GGCTCGCAGC ACACACAACC ATGATGCTCC ACCACGAAGC AAGTGTGCAA CAAGCGCGAG AGGAAGAAGA
AGAGCTTGAT CACCATGGCG ATCCGATGAT CACCTCCCCT CTCTGTGAGC ACCCAGAACC CAGAAGCAAG ATCATATATT
GTTATTTCAT TTTCCTTTTT TTAACGAATA AGATCAACGA GATTATATAT ATATATATAT GGCCTTCATC GTATATATGT
TGCTGACTGA TGATGCTCGT GCACAGTGCG ACCATCGACG TCGGGCAGCT CGCCGGAGAA TGGAGAGGAG GAGAACTCAC
CGGTGGAGCT GGTGGCGCTG ACGGTGCCAG TGAGCGACGA GCCGGAGACG CCGGTGCTGA CGTTCAGGAT GTGGGTGCTG
GGGACGGCGT CGTGCGCGGT GCTCTCCTTC CTTAACCAGT TCTTCTGGTA CCGCAAGGAG CCGCTCACCA TCACCGCCAT
CTCCGCGCAG ATCGCCGTCG TGCCGCTCGG CCGCCTCATG GCGGCGACGC TGCCGGAGCA CGCCTTCTTC CGTGGCCGGC
CGTGGGAGTT CACGCTTAAT CCGGGGCCGT TCAATGTCAA GGAGCACGTG CTCATCACCA TCTTCGCCAA CTCCGGCGCC
GGCACCGTCT ATGCCATCCA CGTCATCACC GGCGTCCGTG TCTTCTACGG GAAAACCCTC TCCTTCTTCA TCTCCCTCCT
TGTCGTCCTC ACAACACAGG TGCATGCAAA CTAGCTTCTG CCTAAACATT TAATAAATTA AGTTGTCAAC GCCCTGATGC
TAGATTAGCT TAATTACCTG GCAATCAAAA ATAGAAAAAA ATATTTCTTC CTTCTCATGC GTGTACGATA CAGTACCATC
AGATGCTGGG GTTCGGCTGG GCGGGAATAT TCCGGCGTTA TCTTGTTGAG CCGGCGTCTA TGTGGTGGCC ATCCAACCTA
GTGCAGGTCT CTCTGTTCAG GTACACTGCT TGAAAACCAG AGTAGATAGT ATGACAAAAA ATCTTCTCAC CAGAGTTGAA
TTCTTGCAAA ATTTTGATCC ACTCAAACCT CCACACCGGC AATGCAAGAG TCTGAACCAC CACATATGTT CCACTTGGAA
GTTGGAACCG CTGCAGTGCT GCACCGAACT ACAACAAAAA TGGAAGAAGA AAAGTGACAT AGTTAGGAGC TGAGGGACCT
CTTATATATT TTCTCTATTA TTTTTTCAAG AAGCTTCCCT AGCTAAGAAT GACAGGACAA ACACAAACCA AATTCTGTTT
GAGTATAGTA AGAAATCCAA GATTTAAACA TATGTAAAAC TAAAACTAAA ATGGAGTTGT GCATATACAC ATTCTTAGCT
CTGAAACGAC AAAGAAGTTT GCATTTGCAT TCCGTAAGAA AATAACTTAC ATATTTCTTA TACTAGCGCA CTTCATGAGA
AGGAAGCACG GAGAAAAGGT GGCTTGACGC GGAACCAGTT CTTCCTGGTG GCATTCGTCT GCAGCTTTGC ATACTACATC
TTCCCAGGCT ACCTATTCCA GATGCTCACC TCCCTCTCCT GGATCTGCTG GGTCTTCCCC AGCTCTGTCC TTGCCCAACA
GCTTGGTTCA GGTCTCCGAG GCCTCGGCGT TGGTGCAATC GGTCTCGACT GGTCATCTAT CTCCTCCTAC CTTGGGAGCC
CTCTTGCTAG CCCATGGTTT GCCACTGTAA ATGTTGGTGT TGGCTTCTTC ATCGTCATGT ACATAATCAC ACCAATTGCA
TACTGGTTTA ATTTCTACAA GGCACAAAAT TTCCCCATAT TTTCTGATGG CCTCTTCACC TCGACTGGGC AAAAATACAA
TGTATCAAGC ATTGTTGACT CCCATTTCCA TTTTGACACC AAGGCCTATG AGAAGAATGG GCCACTATAC CTCAGTACTT
CCCTTCTTGT CACATACGGT GTTGGTTTTG CAACCCTTGC TGCAACAATT GTTCATGCTC TCCTCTTCCA TGGAAGGTAT
TTTTTTTTCT TAGATTCGCC ACTCCACTGT CTACAATATT AAAATAATGT GGTTAAGAAC CATGATACTT GTCTCCAGTG
AAATTTGGCT ATTAAGTAAA TCAGCTTTTC AAGAAAAAAG GATGGACATA CACACGAAAC TTATGAGGAG ATATAAACAG
GTCCCTGAGT GGTGGTTCAT ATGCATCCTT ATTGCTAACA TCGGAACGAC CATATTTGCT TGTGAATACT ACAATGAGGA
ACTCCAATTG CCCTGGTGGG GTGTTTTGTT TGCATGCTCC ATTGCCTTTT TCTTCACCCT CCCAATAGGG ATAATCAAAG
CAACAACAAA TCAGGTATGT GGATTTAACA CATTGTGCAT ATTATGTCAT ACAGATCTAA CCAGTTCAGC CTTTTTCATT
ATATACAGAC TCCAGGCCTG AATGTCATCA CGGAGTACAT TATTGGGTAT CTGTACCCTG GACGACCCGT TGCAAATATG
TGCTTCAAGG TATATGGTTA CATCAGCATG AAACAAGCTT TGGCATTTCT TGAAGATTTT AAGCTGGGTC ACTACATGAA
GATTCCACCG AGGACAATGT TTATGGCTCA GGTAAGTTCT ATTAGCCCTA TAATGACTTA TGTATCATTT CTCCTAAAGA
GTAGACATTT GGTTCTATTG TATCGTGTGA TTTACAAACT TCTCCAAACA TGACAGGTGG TGGGAACTTC AATTGCAGCA
TTTGTGTATA TTGGCACAGC ATGGTGGCTA ATGGAGACAA TCCCCAACAT CTGCAACACT GAGCTCCTCC CGTCAGATAG
CCCTTGGACC TGCCCAGGTG ACCATGTATT CTATGATGCA TCAGTCACAT GGGGACTTAT TAGCCCGCGC AGGATATTTG
GGGACTTAGG CACTTATTCA GCTCTAAATT GGTTCTTTTT GTGTGGAGCT ATTGCCCCTC TACTTGTCTG GTTTGCACAC
AAGACATTCC CAGGCCAGAA CTGGATCTTA CTCATCAAGA CGCCTGTACT AATTGGTGCC ACCTTCCAGA TGCCTCCTGC
TACTGCCGTC AACTACACGA CTTGGATACT TGTTGGGTTC TTGTCAGGTT ATGTGGTCTA TAGATATCGA CGTGATTGGT
GGGAGAGACA CAATTATCTG CTTTCAGGTG CACTGGATGC TGGTTTGGCT TTCATGGCGG TCTTAATTTA CTTGTGCTTA
GGCTTGGAGG ACATCAGTCT GAACTGGTGG GGAAATGACT TGGATGGGTG TCCTTTGGCT TCTTGTCCCA CTGCTAAAGG
TATAGTTGTC AAGGGATGTG CAGTCTATAC TTGAGGATCT CCTATTGCTT CTTGTCCCAC TGCTACAGTG TTACCCAGAC
CTCCATGGGT GCAAGCCAAT ATGATTAGAT CTAATTTGAC CCTTGTCATC TATAAACATC AGTAGAACCA GCTTTGATTC
ATAGCTGGAA ATTAGCAATG TAGTTTCAGG GTTAGTGGTC ATAACTTGTA TCCTATCAGT ATTCTCGAAA AAACTTGTAT
CCTACCAAAC AAGTTAAATT TTGATCTCTG 

Locus: Os06g0125500

Loading...

Locus: Os06g0125500

Loading...