Os06t0125800-01

Locus

Os06g0125800

Description

RING finger protein with E3 ligase activity, Mediation of broad-spectrum disease resistance

RAP-DB Gene Symbol Synonym(s)

OsBBI1

RAP-DB Gene Name Synonym(s)

BLAST AND BTH INDUCED 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBI1

Oryzabase Gene Name Synonym(s)

BLAST AND BTH INDUCED 1

Transcript Evidence

AK068302

AK104425

Protein Evidence

Q9LWV9

Literature

PMID: 21221134

Note

Manual Curation

April 1, 2020

Functional domain (InterPro)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type (IPR001841)

Full-length cDNA

J013144A04 (Online Clone Ordering)

006-205-F10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0125800-01)

RiceXPro (AK068302)

Others

Oryzabase (14294)

KEGG (Os06t0125800-01)

Transcript

1057 bp

>Os06t0125800-01 RING finger protein with E3 ligase activity, Mediation of broad-spectrum disease resistance
ATTAACAAAGAATCCGTCCAGCCTTGAGAAGCAGAGAAGAGGAGAGAAACAAGAGACAGA
CAGACAGAGATAGAGTAACTGAGTAAACGGGTTCTTGCCTGACATTTGTCTTGTCCGGGT
GGCCATTCATGGCCACCGTGGGGCAGCCTGATGCCATGAGAAGGATCACCGTTCACTACG
TGAATCCGCCGCCGATCGCCGGCGCCGGAGAAGCACACGTCGATGGCCTCGACGACGAGG
TTCTTGATTATGTGATTGGTGATGTTCTTCAGGATCAGGAGGGTCTGTATCAATCGATAT
TGTATGGCAAATACGGGGATGACATGAGAGGGGCAAGAAACACTGCTCTTGCCCAATCTG
ATGGTTTACATTACTACTATCACGGAGAGAACAGCAGTGGTGAAGCAACAACCTCGAGAA
ATTCAGAAATCGACCAACAGATTGAGTATGACTTGGTGTTCGCTAGGCAGCTGCAGGCAA
TGGATAATCTGACAATTGAGACACCTGCAGATGAAGATGATGATATAAGCTGCGTACCCT
CTCCATCTGACTCTGAAACCGATGAACCGGCAGAAGGCAACAACGAAGAGGCTGCCACAC
AGGATGATAACGATGATCCAGACAACATGACATACGAGCAAAGGCAGGCACTTGTGGAAT
CTGTAGGAAATGAGAACAGAGGTTTATCTGATCTGCTTATCTCCTACTTGGAGACATGGA
AGTACAAATCAGGCTTTTTCCCAAGGAAGGCAAACCATGATAACTGTCCTATATGTCTAT
CCGCTTTCAGACGCCGAGAAACACTCATTACATTGGCTTGCAAGCATAGTTACCATGAAG
GTTGTATTGCTAGATGGCTCAAGATTGACAAGGCCTGCCCAGTTTGCAAATATGAAGTGT
TTGGACCTTCCTAGCGTGTGAGGAGGCGATCAACAAGGCTGACCAACTATGACTCGATGA
GACGGCATATAGTGGTTGCAGCATCTGCTCTGCAGTATTAATTAAAAAGGGAAACCTTAA
CTCCCAAAAAAAACAGAGAAGGGAAGAAAAAGAAAGC

CDS

786 bp

>Os06t0125800-01 RING finger protein with E3 ligase activity, Mediation of broad-spectrum disease resistance
ATGGCCACCGTGGGGCAGCCTGATGCCATGAGAAGGATCACCGTTCACTACGTGAATCCG
CCGCCGATCGCCGGCGCCGGAGAAGCACACGTCGATGGCCTCGACGACGAGGTTCTTGAT
TATGTGATTGGTGATGTTCTTCAGGATCAGGAGGGTCTGTATCAATCGATATTGTATGGC
AAATACGGGGATGACATGAGAGGGGCAAGAAACACTGCTCTTGCCCAATCTGATGGTTTA
CATTACTACTATCACGGAGAGAACAGCAGTGGTGAAGCAACAACCTCGAGAAATTCAGAA
ATCGACCAACAGATTGAGTATGACTTGGTGTTCGCTAGGCAGCTGCAGGCAATGGATAAT
CTGACAATTGAGACACCTGCAGATGAAGATGATGATATAAGCTGCGTACCCTCTCCATCT
GACTCTGAAACCGATGAACCGGCAGAAGGCAACAACGAAGAGGCTGCCACACAGGATGAT
AACGATGATCCAGACAACATGACATACGAGCAAAGGCAGGCACTTGTGGAATCTGTAGGA
AATGAGAACAGAGGTTTATCTGATCTGCTTATCTCCTACTTGGAGACATGGAAGTACAAA
TCAGGCTTTTTCCCAAGGAAGGCAAACCATGATAACTGTCCTATATGTCTATCCGCTTTC
AGACGCCGAGAAACACTCATTACATTGGCTTGCAAGCATAGTTACCATGAAGGTTGTATT
GCTAGATGGCTCAAGATTGACAAGGCCTGCCCAGTTTGCAAATATGAAGTGTTTGGACCT
TCCTAG

Protein

262 aa

>Os06t0125800-01 RING finger protein with E3 ligase activity, Mediation of broad-spectrum disease resistance
MATVGQPDAMRRITVHYVNPPPIAGAGEAHVDGLDDEVLDYVIGDVLQDQEGLYQSILYG
KYGDDMRGARNTALAQSDGLHYYYHGENSSGEATTSRNSEIDQQIEYDLVFARQLQAMDN
LTIETPADEDDDISCVPSPSDSETDEPAEGNNEEAATQDDNDDPDNMTYEQRQALVESVG
NENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLSAFRRRETLITLACKHSYHEGCI
ARWLKIDKACPVCKYEVFGPS*

5'UTR

chr06:1383618..1383699 (+ strand) : 82 bp

chr06:1384027..1384072 (+ strand) : 46 bp

CDS

chr06:1384073..1384222 (+ strand) : 150 bp

chr06:1384429..1384672 (+ strand) : 244 bp

chr06:1384791..1384858 (+ strand) : 68 bp

chr06:1385043..1385090 (+ strand) : 48 bp

chr06:1385187..1385311 (+ strand) : 125 bp

chr06:1385460..1385568 (+ strand) : 109 bp

chr06:1385784..1385825 (+ strand) : 42 bp

3'UTR

chr06:1385826..1385968 (+ strand) : 143 bp

FASTA

>Os06t0125800-01 class=Sequence position=chr06:1383618..1385968 (+ strand)
ATTAACAAAG AATCCGTCCA GCCTTGAGAA GCAGAGAAGA GGAGAGAAAC AAGAGACAGA CAGACAGAGA TAGAGTAACT
GAGTAAGCAT CTCGATCTTG GCATGTTCTT TCTTCTTCCC CTTTCCCTTC ATTGATTCTC CTCTTGTTTT CCTCATCACA
AACTCCTGCA GAGACCTGTT CTTCACCTCA ATTCTGCTCT TGTTATATTG CCTGGATTCC TTTTTTTTTT TGGTTCTTGG
AAGCTTCTAT TGCCGCTGCT TGTTCTTGAG TGCCCTCTGC AATTTATAGA TAATTTTCTT CAGTTTTTTT ATCCAAAAAG
AGTTCTTGGA TTAGTTGTAA AGAAGAGGTT AAATCAAGGA AGGTTGCATC TTGTTCTTGA CTGATTAATT GGTGTGCCAT
GATCTGCAGG TAAACGGGTT CTTGCCTGAC ATTTGTCTTG TCCGGGTGGC CATTCATGGC CACCGTGGGG CAGCCTGATG
CCATGAGAAG GATCACCGTT CACTACGTGA ATCCGCCGCC GATCGCCGGC GCCGGAGAAG CACACGTCGA TGGCCTCGAC
GACGAGGTTC TTGATTATGT GATTGGTGAT GTTCTTCAGG ATCAGGTATG CATTTGATCC AACCTTTCCA TCATTATTAG
CATACTGCTC TTACAGGCTT GCAGAATGAT GAGCTTTAGC ATCAAACATA TGTTTCTAAG CCTTTGATAT GGCCTCTTTA
CTTTAGTTCA ACATTGTTTA GTAAACTTTC CACTGTTTCT CTGAAACTTT TTTGAGAATA AACTTATTTG TTTTTCTGAA
CTTTTTTCTA GGAGGGTCTG TATCAATCGA TATTGTATGG CAAATACGGG GATGACATGA GAGGGGCAAG AAACACTGCT
CTTGCCCAAT CTGATGGTTT ACATTACTAC TATCACGGAG AGAACAGCAG TGGTGAAGCA ACAACCTCGA GAAATTCAGA
AATCGACCAA CAGATTGAGT ATGACTTGGT GTTCGCTAGG CAGCTGCAGG CAATGGATAA TCTGACAATT GAGACACCTG
CAGATGAAGA TGATGGTATG CATTCATTCT CGTTCAGTTT TTGTAAGCAC TTGATGTGCA TAATGATTTT CAGTCGTGGC
AATCTTAATC TTTTCACCTC TGAAATTTTG TTGCCCATGT TGGTTTGATT CAGATATAAG CTGCGTACCC TCTCCATCTG
ACTCTGAAAC CGATGAACCG GCAGAAGGCA ACAACGAAGA GGTGATTATA TGAGCTGTTT CAGAATTGCA ATTATTCAGC
ATTGTTCGTT TCAGACTTCT TGATGCAAAG ATACACAATT GCGTATTCAC TAAAAAGATG AGCTGTTTCA GAATAAAGCC
TTTCCAAATG GATAATGTAT AAACATGTAC TACGAAAAGT TGAGATTCCT ATCATTTGTT TGCAGGCTGC CACACAGGAT
GATAACGATG ATCCAGACAA CATGACATAC GAGGTTAGTG TTATATTCAC TTGTATCACA TTTCTTCTGT AAAAGAGGTT
TACACCATCT ATGAAAAAGT TGCTGATTCT TATTCTTTCT GTAATCCAGC AAAGGCAGGC ACTTGTGGAA TCTGTAGGAA
ATGAGAACAG AGGTTTATCT GATCTGCTTA TCTCCTACTT GGAGACATGG AAGTACAAAT CAGGCTTTTT CCCAAGGAAG
GCAAACCATG ATAAGTATGT CTACCATTTC AGTTTTCAAT CAATCACATA CTGATTTCTT GCAGAAGATA ATCCAAGCAT
GTAACTGATG ACACTCTGAT TAAAATCTTC ATCATGGCAT GCAACTGATG ATTTCCTCCT CTTTTTTCTC CCAAAATTGC
AGCTGTCCTA TATGTCTATC CGCTTTCAGA CGCCGAGAAA CACTCATTAC ATTGGCTTGC AAGCATAGTT ACCATGAAGG
TTGTATTGCT AGATGGCTCA AGATTGACAA GGTAAACACC TTCTTGGGAC ACTAGATTTG CTATCTGAAT TGTGTACCTA
TCTTAGATTA TACCATTTGT CAAAGTTTAC ATGAGCACTG ATATGCACTG TCCATTTCAT ATAACAAGAT GGTCTTTGTC
TTTCAGTTTC CTTGAGCTTC TTCCAAATTA AAAGAACTTC ATGGGCTTGT GCAGTGGAAT TCCTGACATT TTTGTTTATG
AAACAGGCCT GCCCAGTTTG CAAATATGAA GTGTTTGGAC CTTCCTAGCG TGTGAGGAGG CGATCAACAA GGCTGACCAA
CTATGACTCG ATGAGACGGC ATATAGTGGT TGCAGCATCT GCTCTGCAGT ATTAATTAAA AAGGGAAACC TTAACTCCCA
AAAAAAACAG AGAAGGGAAG AAAAAGAAAG C

Locus: Os06g0125800

Loading...

Locus: Os06g0125800

Loading...