Os06t0126500-01

Locus

Os06g0126500

Description

Ubiquitin domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BAG3

CGSNL Gene Name

BCL-2-ASSOCIATED ATHANOGENE 3

Oryzabase Gene Symbol Synonym(s)

OsBAG3

Oryzabase Gene Name Synonym(s)

Bcl-2-associated athanogene 3

Transcript Evidence

AK065197 (DDBJ, Best hit)

Protein Evidence

NP_001149344.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: chaperone binding (GO:0051087)

Functional domain (InterPro)

Ubiquitin (IPR000626)

BAG domain (IPR003103)

Ubiquitin supergroup (IPR019955)

Full-length cDNA

J013002E17 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0126500-01)

RiceXPro (AK065197)

Others

Oryzabase (11555)

KEGG (Os06t0126500-01)

Transcript

1790 bp

>Os06t0126500-01 Ubiquitin domain containing protein.
GTTCCCTCATCAACCTCACCACCATTATTTTCTTCTCTCCTCTTCTCTTCTTCCTCCTCT
CCTCTCCTCTCCTCGCTCTCCATCCATCTCGTCTTCTTCTTCCTCCTCCTCAGCTTCGAG
ATTTCAGCTTCTCCAAACCCCCATTCTTCCCGCCACAAGCTCTGCTCTGTGCTTTGCTCG
CTCGCCTTTCCCGCCATTGGTGTGCTTCGCTTTCTTGGCTTCAAAGATCCGACGAGCTCT
GTGATAGCTGGGGAGAAGAAGAGGAGGAGAGGAGGATGCTGGGAGCGAGCCCTAAGGCCA
AGAAAGGCGCGACGGTGAAGTTCGGGTCGATGAAGAATCCTCCTCCTCCCCcggtggttg
gcgccgccgccggagcagcggcggcggcggcgggtgggaaggtgccggcggaggaggtgt
gggaggtgcggccaggcgggatgctggtgcagaagaggggcggcggcgccgacgaggagc
ccgtcAACGTGAAGCCGGTGCCCACCATCCGCGTCAAGGTCAAGCACGCCGGCATCACCC
ACGAGATCTACATCAACTCGCAGGCGTCCTTCGGGGAGCTGAAGAAGATGGTGGCGGCGC
GAACGGGGCTGCATCCGGACGACCAGAAGGTGATGTACAAGGACAAGGAGAGGGACTCCA
AGGCGTTCCTGGACATGGCCGGCGTCAAGGACAGGTCCAAGCTGGTGGTCGTCGAGGACC
CCGAGGCACGCGCCCGCCGCCTCATCGAGGAGCGCCGCAATGGCCACCTCGAGAAGGCCG
CCAAGGCCGTCGCCGCCGTCACCGCCGAGGTCGACAAGCTCGCCCCCAAGGTGGCGGCGC
TGGACGCGTCGGTGAGGAAGGGGGAGAAGGTGGCGGAGAACGACGTGGTGCAGGTGACCG
AGCTGCTCATGAACGAGCTGCTCAAGCTCGACGCGGTGGTCGCCGACGGCGACGTCAAGG
CGCAGAGGCGGCTACAGGTGAAGCGCGTGCAGAAGTACGTGGAGACGCTCGACGCCGTCA
TGGCCAAGAACGCCGCCATCGTGCGCAAGTCCGGCGAGAAGCTCACCTCCAAACAACACC
ATCACCCGCCGGCGAGGCAGCAGCAGCAGCAAGCTCACCAACACCATCAGCAGCCGGCGG
CGGGGCAGACGCGGTGGGAGATGTTCGACCTGCTGTCCTCGCTGCCGTCGACGTCGTCGG
CCTCCTCAACGACCACCGTCAGCTCAACGGCCTCCTCCGGCGCGCCGCCGCCGCTGCCGC
CGCCGGCGAACCGGCTCGACTGGATGCTATTCTGAGCACACACATCACAGAATCGGCAGA
TGCAATGGTGGTGCTTGGTTGGCAAGAATTGCACCCATGTCCGGAAAATCCGAGGTGTCC
TGTCCCTGATGAGATGATGATGAAGATGATGATTGAATTGCCCTGGATTATTTGCTGCTG
CTCTAGCAATTTGGTTGGCCACATTACATGGTACTACTACCACTTCTAGATGAGTTCAGT
TCATCATGTGAGAGTAATTTTTTTTTAATTTTGTTTTTTCTTTCTTTCTTTCTTTCTTCT
TCTTCTTCACCATCAAATGTTTGATATTCTTTTGTGTGCATATATTCTGAGAAAGAGAGA
GAGAGAGAGAGAGAGAGAGGAAATTAGGGGGGAAGAGAGAAATTGAAGTGTATTCAGATT
GGGAATAAGTCAAAAAGGGTTATTATTGTTCTCCAATTGGCGTTTGAAGAAAAGGCAAAG
AAAATGTTGTACCCATATGGATACAGATACCAATACATACCGTTCTTGAT

CDS

1020 bp

>Os06t0126500-01 Ubiquitin domain containing protein.
ATGCTGGGAGCGAGCCCTAAGGCCAAGAAAGGCGCGACGGTGAAGTTCGGGTCGATGAAG
AATCCTCCTCCTCCCCcggtggttggcgccgccgccggagcagcggcggcggcggcgggt
gggaaggtgccggcggaggaggtgtgggaggtgcggccaggcgggatgctggtgcagaag
aggggcggcggcgccgacgaggagcccgtcAACGTGAAGCCGGTGCCCACCATCCGCGTC
AAGGTCAAGCACGCCGGCATCACCCACGAGATCTACATCAACTCGCAGGCGTCCTTCGGG
GAGCTGAAGAAGATGGTGGCGGCGCGAACGGGGCTGCATCCGGACGACCAGAAGGTGATG
TACAAGGACAAGGAGAGGGACTCCAAGGCGTTCCTGGACATGGCCGGCGTCAAGGACAGG
TCCAAGCTGGTGGTCGTCGAGGACCCCGAGGCACGCGCCCGCCGCCTCATCGAGGAGCGC
CGCAATGGCCACCTCGAGAAGGCCGCCAAGGCCGTCGCCGCCGTCACCGCCGAGGTCGAC
AAGCTCGCCCCCAAGGTGGCGGCGCTGGACGCGTCGGTGAGGAAGGGGGAGAAGGTGGCG
GAGAACGACGTGGTGCAGGTGACCGAGCTGCTCATGAACGAGCTGCTCAAGCTCGACGCG
GTGGTCGCCGACGGCGACGTCAAGGCGCAGAGGCGGCTACAGGTGAAGCGCGTGCAGAAG
TACGTGGAGACGCTCGACGCCGTCATGGCCAAGAACGCCGCCATCGTGCGCAAGTCCGGC
GAGAAGCTCACCTCCAAACAACACCATCACCCGCCGGCGAGGCAGCAGCAGCAGCAAGCT
CACCAACACCATCAGCAGCCGGCGGCGGGGCAGACGCGGTGGGAGATGTTCGACCTGCTG
TCCTCGCTGCCGTCGACGTCGTCGGCCTCCTCAACGACCACCGTCAGCTCAACGGCCTCC
TCCGGCGCGCCGCCGCCGCTGCCGCCGCCGGCGAACCGGCTCGACTGGATGCTATTCTGA

Protein

340 aa

>Os06t0126500-01 Ubiquitin domain containing protein.
MLGASPKAKKGATVKFGSMKNPPPPPVVGAAAGAAAAAAGGKVPAEEVWEVRPGGMLVQK
RGGGADEEPVNVKPVPTIRVKVKHAGITHEIYINSQASFGELKKMVAARTGLHPDDQKVM
YKDKERDSKAFLDMAGVKDRSKLVVVEDPEARARRLIEERRNGHLEKAAKAVAAVTAEVD
KLAPKVAALDASVRKGEKVAENDVVQVTELLMNELLKLDAVVADGDVKAQRRLQVKRVQK
YVETLDAVMAKNAAIVRKSGEKLTSKQHHHPPARQQQQQAHQHHQQPAAGQTRWEMFDLL
SSLPSTSSASSTTTVSSTASSGAPPPLPPPANRLDWMLF*

5'UTR

chr06:1414221..1414495 (+ strand) : 275 bp

CDS

chr06:1414496..1414793 (+ strand) : 298 bp

chr06:1414882..1415138 (+ strand) : 257 bp

chr06:1415240..1415386 (+ strand) : 147 bp

chr06:1415486..1415803 (+ strand) : 318 bp

3'UTR

chr06:1415804..1416298 (+ strand) : 495 bp

FASTA

>Os06t0126500-01 class=Sequence position=chr06:1414221..1416298 (+ strand)
GTTCCCTCAT CAACCTCACC ACCATTATTT TCTTCTCTCC TCTTCTCTTC TTCCTCCTCT CCTCTCCTCT CCTCGCTCTC
CATCCATCTC GTCTTCTTCT TCCTCCTCCT CAGCTTCGAG ATTTCAGCTT CTCCAAACCC CCATTCTTCC CGCCACAAGC
TCTGCTCTGT GCTTTGCTCG CTCGCCTTTC CCGCCATTGG TGTGCTTCGC TTTCTTGGCT TCAAAGATCC GACGAGCTCT
GTGATAGCTG GGGAGAAGAA GAGGAGGAGA GGAGGATGCT GGGAGCGAGC CCTAAGGCCA AGAAAGGCGC GACGGTGAAG
TTCGGGTCGA TGAAGAATCC TCCTCCTCCC Ccggtggttg gcgccgccgc cggagcagcg gcggcggcgg cgggtgggaa
ggtgccggcg gaggaggtgt gggaggtgcg gccaggcggg atgctggtgc agaagagggg cggcggcgcc gacgaggagc
ccgtcAACGT GAAGCCGGTG CCCACCATCC GCGTCAAGGT CAAGCACGCC GGCATCACCC ACGAGATCTA CATCAACTCG
CAGGCGTCCT TCGGTCAGTG CCCGCCGCCG CCGTCGTCGT CGTCGTCGAC GGCGAACTCG ATGGATGGGG GCCATGTCTG
ATTTCGTTGT GGGTGGTGCA GGGGAGCTGA AGAAGATGGT GGCGGCGCGA ACGGGGCTGC ATCCGGACGA CCAGAAGGTG
ATGTACAAGG ACAAGGAGAG GGACTCCAAG GCGTTCCTGG ACATGGCCGG CGTCAAGGAC AGGTCCAAGC TGGTGGTCGT
CGAGGACCCC GAGGCACGCG CCCGCCGCCT CATCGAGGAG CGCCGCAATG GCCACCTCGA GAAGGCCGCC AAGGCCGTCG
CCGCCGTCAC CGCCGAGGTC GACAAGCTCG CCCCCAAGGT AGGCACCCAC CCACATTGCC CGCCATCCAT GGCGACGCCG
ACGCCGAGGT AGTAGGCTCA CCTCCGATTG GTTGGTTGGT TGGTTGGTTG GTTCGGCAGG TGGCGGCGCT GGACGCGTCG
GTGAGGAAGG GGGAGAAGGT GGCGGAGAAC GACGTGGTGC AGGTGACCGA GCTGCTCATG AACGAGCTGC TCAAGCTCGA
CGCGGTGGTC GCCGACGGCG ACGTCAAGGC GCAGAGGCGG CTACAGGTGA GCTGACGAGC TACCTCGCCG CCTCCTCCAA
TCTCCACCGA CTAGCTTGAC CGCCATGGTT AATGAGCTCA ACCTGTTCGT CCCATGACTC TGCAGGTGAA GCGCGTGCAG
AAGTACGTGG AGACGCTCGA CGCCGTCATG GCCAAGAACG CCGCCATCGT GCGCAAGTCC GGCGAGAAGC TCACCTCCAA
ACAACACCAT CACCCGCCGG CGAGGCAGCA GCAGCAGCAA GCTCACCAAC ACCATCAGCA GCCGGCGGCG GGGCAGACGC
GGTGGGAGAT GTTCGACCTG CTGTCCTCGC TGCCGTCGAC GTCGTCGGCC TCCTCAACGA CCACCGTCAG CTCAACGGCC
TCCTCCGGCG CGCCGCCGCC GCTGCCGCCG CCGGCGAACC GGCTCGACTG GATGCTATTC TGAGCACACA CATCACAGAA
TCGGCAGATG CAATGGTGGT GCTTGGTTGG CAAGAATTGC ACCCATGTCC GGAAAATCCG AGGTGTCCTG TCCCTGATGA
GATGATGATG AAGATGATGA TTGAATTGCC CTGGATTATT TGCTGCTGCT CTAGCAATTT GGTTGGCCAC ATTACATGGT
ACTACTACCA CTTCTAGATG AGTTCAGTTC ATCATGTGAG AGTAATTTTT TTTTAATTTT GTTTTTTCTT TCTTTCTTTC
TTTCTTCTTC TTCTTCACCA TCAAATGTTT GATATTCTTT TGTGTGCATA TATTCTGAGA AAGAGAGAGA GAGAGAGAGA
GAGAGAGGAA ATTAGGGGGG AAGAGAGAAA TTGAAGTGTA TTCAGATTGG GAATAAGTCA AAAAGGGTTA TTATTGTTCT
CCAATTGGCG TTTGAAGAAA AGGCAAAGAA AATGTTGTAC CCATATGGAT ACAGATACCA ATACATACCG TTCTTGAT

Locus: Os06g0126500

Loading...

Locus: Os06g0126500

Loading...