Os06t0127700-01

Locus

Os06g0127700

Description

Similar to Oligopeptide transporter 9.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOPT4

Oryzabase Gene Name Synonym(s)

Oligopeptide transporter 4

Transcript Evidence

AK072617 (DDBJ, Best hit)

Protein Evidence

B6SVF4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Tetrapeptide transporter, OPT1/isp4 (IPR004648)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023127G03 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0127700-01)

Others

Oryzabase (12497)

Transcript

2825 bp

>Os06t0127700-01 Similar to Oligopeptide transporter 9.
GGCACAGCTCCCAACTCCTCCCATTATCCATCCATGGCGTCCTCCCATCACCAAGAAGTA
CAAGAGCAAGGCCATGGAGATGGAGAGGAAGAGGAACAAGATAATAGCCAAATCACCTCT
CCACTGTTGCGATCCTCAATGCggctcggctcgccggaggagaactcgccggtggagcag
gtggcgctgacggtgccggtgggggacgacccggcgacgccggTGCTGACGTTCCGGATA
TGGGTGCTGGGCACGGCGTCCTGCGTCGTGCTGTCCTTCCTCAACACCTTCTTCTGGTAC
CGCAAGGAGCCGCTCACCGTCACGGCCATCTCGGCGCAGATCGCCGTCGTGCCGCTCGGC
CGCCTCATGGCCGCCGCGCTGCCGGAGCGCGTCTTCTTCCGTGGCCGGCCGTGGGAATTC
ACCCTCAACCCTGGCCCGTTCAACGTCAAGGAGCACGTGCTCATCACCATCTTCGCCAAC
GCCGGTGCCGGTTCCGTCTTCGCCATTAACGTCATCACCGCCGTCCGAGTCTTCTACGGG
AAGCGCATCTCCTTCTTCGTCTCCCTCCTCGTCGTCCTCACCAGCCAGGTGCTGGGATTC
GGGTGGGCGGGAATATTCCGGCGGTATCTGGTGGAGCCGGCGGCGATGTGGTGGCCGTCC
AACCTCGTGCAGGTCTCCCTCTTCAGGGCACTTCATGAAAAGGAACGGAGGAGCAAAGGC
GGCATGACACGCACCCAGTTCTTCTTGGTAGCATTTGTGTGCAGCTTTGCCTACTACATT
TTCCCAGGCTACCTATTCCAGATGCTCACTTCCCTCTCCTGGATTTGTTGGATCTTTCCC
AAATCTGTGCTCGCACAACAGCTTGGATCAGGTCTCCATGGCCTTGGCATTGGTGCAATT
GGACTCGACTGGTCATCCATCTCGTCATATCTCGGAAGCCCACTGGCTAGCCCATGGTTT
GCCACTGCCAACATTGCTGCCGGCTTCTTCATCTACATTTATGTAATCACACCAATCGCC
TACTGGATTAATCTCTACAAGGCACAAAACTTCCCTATCTTTTCAGATGGCCTTTTCACA
GTGACTGGACAGAAGTACAACATCTCTACCATTATAGACTCACAGTTTCATTTTGATACA
AAAGCCTATGAGAAGAATGGACCATTATACATCAGCACCTTCTTTTCTATCAGCTATGGT
CTTGGTTTTGCATGTCTTACTGCAACAGTTGTCCACGTTCTTCTTTTCCATGGAAGTGAA
ATTTGGCAGCTAAGCAGATCAGCTTTTCAAGATAAAAAGATGGACATACATACAAAGCTT
ATGAAGAGGTACAAACAGGTTCCTGAATGGTGGTTCATCTCCATCCTTATAGCCAGTGTT
GCAATCACCATGTTCACTTGTGAGTATTACATAGAACAATTGCAGTTACCCTGGTGGGGG
GTACTACTTGCATGTGCCCTTGCAATTTTCTTCACCCTTCCAATTGGAATCGTCACAGCA
ACGACAAACCAGACTCCAGGCTTGAATATCATCACGGAATACATCATGGGGTACTTGTAT
CCTGGACGACCTGTCGCAAACATGTGCTTCAAGGTATATGGTTACATTGGCCCACAGCAA
GCCCTAGCATTCCTACAAGATTTTAAGCTGGGACACTACATGAAGATTCCACCAAGGACC
ATGTTTATGGCTCAGGTGGTGGGCACTTTGATAGCAGCATTTGTGTACCTTGGAACAGCA
TGGTGGCTCATGGATACAATCCCTAACATATGCAACACCGAGCTCCTCCCCCCAGGCAGC
CCTTGGACCTGCCCTTATGATCATTTATTCTATGATGCATCAGTCATATGGGGCCTTATT
GGCCCACGCAGAATATTTGGTGATTTAGGCACTTATTCTGCTGTCAACTGGTTCTTCTTG
GGGGGTGCCATTGCTCCCCTCCTCGTCTGGTTTGCACACAAGGCATTCCCAGGTCAGAAA
TGGATCCTACTTGTCAACATGCCTGTGCTGATCGCCGGAATCAGCCAGATGCCTCCTGCC
ACTTCAGTCAACTACACGGCATGGATATTTGTAGCATTTTTGTCAGGTTATGTGGTCTAT
AAGTACCGTCGTGACTGGTGGGAGAGACACAATTATCTACTTTCAGGTGCCCTTGATGCT
GGTTTGGCATTCATGGCTGTCTTGCTATATTTATGCCTAGGACTAGAGAAAATCAGTTTG
AACTGGTGGGGTAATGATTTGGATGGTTGTCCATTAGCTTCTTGCCCCATTGCGGAAGGT
ATAACTGTACAGGGGTGTCCAGTGGCAAGTGCATAGCCAAGTTTCTTCTCATCCACAGTA
CCGCCGGCAATGGTATCTCAATCATCTTAAGGAGGATGCAAAGATCAAAGAACCATGCAG
AGAGGCTTTAAACAACTCAAAATGAAGACCAAAAAGAAAATGTCCATATGTTACAAGGAA
GATGATACTACAAGGTGTACCGAATACAAAAATAAGTAAAGTTATTTGGTGCATGCTAAA
TTGTTGCCGGTGACAGAAAACAGATTATGATAATAGATGAACTGAATTTCTGAAACCAAC
ACTGAATTGAAAGACAGTAGCCATCGTCCATAGAAATAGTTAAAGTCTGAACATGATTCC
ACTTACCTGTAAAGGTAACATCAGGATCACCTTAGCCTTTAATCATCACAAGAACCTTGC
AGGAAAAAGTAAGAAATTCAGATGTTACTTTTGCTTTGAGGGAAAATGAAACAATACGGT
CAGCATGTAATCCTGTATGAAACATGGATAATATAAACTGCATTATATATTGTTTCATTG
GAAGT

CDS

2283 bp

>Os06t0127700-01 Similar to Oligopeptide transporter 9.
ATGGCGTCCTCCCATCACCAAGAAGTACAAGAGCAAGGCCATGGAGATGGAGAGGAAGAG
GAACAAGATAATAGCCAAATCACCTCTCCACTGTTGCGATCCTCAATGCggctcggctcg
ccggaggagaactcgccggtggagcaggtggcgctgacggtgccggtgggggacgacccg
gcgacgccggTGCTGACGTTCCGGATATGGGTGCTGGGCACGGCGTCCTGCGTCGTGCTG
TCCTTCCTCAACACCTTCTTCTGGTACCGCAAGGAGCCGCTCACCGTCACGGCCATCTCG
GCGCAGATCGCCGTCGTGCCGCTCGGCCGCCTCATGGCCGCCGCGCTGCCGGAGCGCGTC
TTCTTCCGTGGCCGGCCGTGGGAATTCACCCTCAACCCTGGCCCGTTCAACGTCAAGGAG
CACGTGCTCATCACCATCTTCGCCAACGCCGGTGCCGGTTCCGTCTTCGCCATTAACGTC
ATCACCGCCGTCCGAGTCTTCTACGGGAAGCGCATCTCCTTCTTCGTCTCCCTCCTCGTC
GTCCTCACCAGCCAGGTGCTGGGATTCGGGTGGGCGGGAATATTCCGGCGGTATCTGGTG
GAGCCGGCGGCGATGTGGTGGCCGTCCAACCTCGTGCAGGTCTCCCTCTTCAGGGCACTT
CATGAAAAGGAACGGAGGAGCAAAGGCGGCATGACACGCACCCAGTTCTTCTTGGTAGCA
TTTGTGTGCAGCTTTGCCTACTACATTTTCCCAGGCTACCTATTCCAGATGCTCACTTCC
CTCTCCTGGATTTGTTGGATCTTTCCCAAATCTGTGCTCGCACAACAGCTTGGATCAGGT
CTCCATGGCCTTGGCATTGGTGCAATTGGACTCGACTGGTCATCCATCTCGTCATATCTC
GGAAGCCCACTGGCTAGCCCATGGTTTGCCACTGCCAACATTGCTGCCGGCTTCTTCATC
TACATTTATGTAATCACACCAATCGCCTACTGGATTAATCTCTACAAGGCACAAAACTTC
CCTATCTTTTCAGATGGCCTTTTCACAGTGACTGGACAGAAGTACAACATCTCTACCATT
ATAGACTCACAGTTTCATTTTGATACAAAAGCCTATGAGAAGAATGGACCATTATACATC
AGCACCTTCTTTTCTATCAGCTATGGTCTTGGTTTTGCATGTCTTACTGCAACAGTTGTC
CACGTTCTTCTTTTCCATGGAAGTGAAATTTGGCAGCTAAGCAGATCAGCTTTTCAAGAT
AAAAAGATGGACATACATACAAAGCTTATGAAGAGGTACAAACAGGTTCCTGAATGGTGG
TTCATCTCCATCCTTATAGCCAGTGTTGCAATCACCATGTTCACTTGTGAGTATTACATA
GAACAATTGCAGTTACCCTGGTGGGGGGTACTACTTGCATGTGCCCTTGCAATTTTCTTC
ACCCTTCCAATTGGAATCGTCACAGCAACGACAAACCAGACTCCAGGCTTGAATATCATC
ACGGAATACATCATGGGGTACTTGTATCCTGGACGACCTGTCGCAAACATGTGCTTCAAG
GTATATGGTTACATTGGCCCACAGCAAGCCCTAGCATTCCTACAAGATTTTAAGCTGGGA
CACTACATGAAGATTCCACCAAGGACCATGTTTATGGCTCAGGTGGTGGGCACTTTGATA
GCAGCATTTGTGTACCTTGGAACAGCATGGTGGCTCATGGATACAATCCCTAACATATGC
AACACCGAGCTCCTCCCCCCAGGCAGCCCTTGGACCTGCCCTTATGATCATTTATTCTAT
GATGCATCAGTCATATGGGGCCTTATTGGCCCACGCAGAATATTTGGTGATTTAGGCACT
TATTCTGCTGTCAACTGGTTCTTCTTGGGGGGTGCCATTGCTCCCCTCCTCGTCTGGTTT
GCACACAAGGCATTCCCAGGTCAGAAATGGATCCTACTTGTCAACATGCCTGTGCTGATC
GCCGGAATCAGCCAGATGCCTCCTGCCACTTCAGTCAACTACACGGCATGGATATTTGTA
GCATTTTTGTCAGGTTATGTGGTCTATAAGTACCGTCGTGACTGGTGGGAGAGACACAAT
TATCTACTTTCAGGTGCCCTTGATGCTGGTTTGGCATTCATGGCTGTCTTGCTATATTTA
TGCCTAGGACTAGAGAAAATCAGTTTGAACTGGTGGGGTAATGATTTGGATGGTTGTCCA
TTAGCTTCTTGCCCCATTGCGGAAGGTATAACTGTACAGGGGTGTCCAGTGGCAAGTGCA
TAG

Protein

761 aa

>Os06t0127700-01 Similar to Oligopeptide transporter 9.
MASSHHQEVQEQGHGDGEEEEQDNSQITSPLLRSSMRLGSPEENSPVEQVALTVPVGDDP
ATPVLTFRIWVLGTASCVVLSFLNTFFWYRKEPLTVTAISAQIAVVPLGRLMAAALPERV
FFRGRPWEFTLNPGPFNVKEHVLITIFANAGAGSVFAINVITAVRVFYGKRISFFVSLLV
VLTSQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHEKERRSKGGMTRTQFFLVA
FVCSFAYYIFPGYLFQMLTSLSWICWIFPKSVLAQQLGSGLHGLGIGAIGLDWSSISSYL
GSPLASPWFATANIAAGFFIYIYVITPIAYWINLYKAQNFPIFSDGLFTVTGQKYNISTI
IDSQFHFDTKAYEKNGPLYISTFFSISYGLGFACLTATVVHVLLFHGSEIWQLSRSAFQD
KKMDIHTKLMKRYKQVPEWWFISILIASVAITMFTCEYYIEQLQLPWWGVLLACALAIFF
TLPIGIVTATTNQTPGLNIITEYIMGYLYPGRPVANMCFKVYGYIGPQQALAFLQDFKLG
HYMKIPPRTMFMAQVVGTLIAAFVYLGTAWWLMDTIPNICNTELLPPGSPWTCPYDHLFY
DASVIWGLIGPRRIFGDLGTYSAVNWFFLGGAIAPLLVWFAHKAFPGQKWILLVNMPVLI
AGISQMPPATSVNYTAWIFVAFLSGYVVYKYRRDWWERHNYLLSGALDAGLAFMAVLLYL
CLGLEKISLNWWGNDLDGCPLASCPIAEGITVQGCPVASA*

5'UTR

chr06:1459768..1459800 (+ strand) : 33 bp

CDS

chr06:1459801..1459894 (+ strand) : 94 bp

chr06:1460003..1460463 (+ strand) : 461 bp

chr06:1460550..1460647 (+ strand) : 98 bp

chr06:1461917..1462486 (+ strand) : 570 bp

chr06:1462566..1462821 (+ strand) : 256 bp

chr06:1462903..1463085 (+ strand) : 183 bp

chr06:1463203..1463823 (+ strand) : 621 bp

3'UTR

chr06:1463824..1464332 (+ strand) : 509 bp

FASTA

>Os06t0127700-01 class=Sequence position=chr06:1459768..1464332 (+ strand)
GGCACAGCTC CCAACTCCTC CCATTATCCA TCCATGGCGT CCTCCCATCA CCAAGAAGTA CAAGAGCAAG GCCATGGAGA
TGGAGAGGAA GAGGAACAAG ATAATAGCCA AATCACCTCT CCACTGTGTA AGCACGGCAA AGCCTAGTCG TCTCAGCTGT
TTTCTTTTTC CCGCCATGGA ACACCACTAG AAGAAAGCAA ACTGTTCTGT TGCCTGATGA GTTCTTCTCG TGCAGTGCGA
TCCTCAATGC ggctcggctc gccggaggag aactcgccgg tggagcaggt ggcgctgacg gtgccggtgg gggacgaccc
ggcgacgccg gTGCTGACGT TCCGGATATG GGTGCTGGGC ACGGCGTCCT GCGTCGTGCT GTCCTTCCTC AACACCTTCT
TCTGGTACCG CAAGGAGCCG CTCACCGTCA CGGCCATCTC GGCGCAGATC GCCGTCGTGC CGCTCGGCCG CCTCATGGCC
GCCGCGCTGC CGGAGCGCGT CTTCTTCCGT GGCCGGCCGT GGGAATTCAC CCTCAACCCT GGCCCGTTCA ACGTCAAGGA
GCACGTGCTC ATCACCATCT TCGCCAACGC CGGTGCCGGT TCCGTCTTCG CCATTAACGT CATCACCGCC GTCCGAGTCT
TCTACGGGAA GCGCATCTCC TTCTTCGTCT CCCTCCTCGT CGTCCTCACC AGCCAGGTAG AGGTGACATC AACGTGCTGC
AGTAATAACA GTACAAGGTG TCATGTACAC TCATGTTCAT GAACTTGAGC TTCATTTTGT AGGTGCTGGG ATTCGGGTGG
GCGGGAATAT TCCGGCGGTA TCTGGTGGAG CCGGCGGCGA TGTGGTGGCC GTCCAACCTC GTGCAGGTCT CCCTCTTCAG
GTAATAAGCA AATAGTAATT CACAATAATT TACTCTCCAC ATGTGCTATA AATCTGATTA TTCAGATATA GCTTGCCTAT
GATTGGTTAA AAGGAGTTGA ATTGCCACTT GTAAAGTAAT CTTTCCACCA GTAGAATACA TTTTTTTTGC GTCGCATGAT
GTGTGCAGCC AGTTGCTTGC AATTGATGTG TTAATAAGGT ACAGCTAAGT GCTAGACTAC CCAAAGATAA CCAACCAACC
ACCTTCCCAA ATCTCAAAAC CAACGTCAAC AAAAAAAAAG ATACTTTGAA CTTTGAAGGA CAAATAAGGG TTTTTATTAA
GCTGGTGTTC AAGTCGTATG TTGTGTGAAC AGCACTGAAT ACGATGGCAC TGCTATTCAG CAATATGCTA ATTATATAAA
AAATATTATC TGTCCTATAT CATGGTTTTG TCATTTTCAT TCATAATAAG CAGAGATATA TTGGCACATC ATGAATTGTC
TAAAAAGTAG ATATTGACAT AATGACTCAA GCGAACAGGA ATCATTTACC AGTCAATTCA ATAATAAAAC CCACCCAGCA
TCATCTTCAT CTGAATTCTA CGCAACAATT AGGAGATTTA GGCGACTTGG ACACTCAGCT ATGCAAGTGC ATGCTGCTGC
AGAAAACCAG AATTCCGTGT ATTTGGAGAT ATCCTGAGTA ATAAAAGAAG CAGTCAATCA ATTTTGACAG ATAAAATTCA
AAGAAAGAAA ACAAGATATA TAAAATATCA TATCACTTCA ATTATAGACG AAGAGCAGCT ATTAAAACTA TAACAAGATT
TTTCGTCCCA AACCAAGGCA TAACAATTTT CCATTTACGA CCAAGGAAAC AAGATCAGTT ACAACCAGCA ACAAGCATCA
ACTAAACCTT ATACAATATC AAGATTCATT TGAGTAAACC CGACTAGACA TTTTAAAACA AGATGTTTAC TTCCCTAGAG
GCTTCAATGA TTTGTCAGAA AAACATGGAT ACAATTTGTC TGCAAATAAA AAAAAAGGTT CAGCATTTTG TTGAGATGAC
ACTTATAAAT CATAATAAGG CATAAATCTG TGTTGCTCTG CCAATGAGTG AATTCATCTA AAACTTTCAG TGGCAATCTG
AAAAGTGAGC TTAATAGCCA TACTGGACAC ACTTGCAAAT GCAGAATCAA ATTAGCAGTA AAATAATAAC TTTCTCCGTA
GTCAAAGGAT GGCTAAAAAA AAACTACCAT AGAAAAGTGA ATAACAGATT TGCTGCACAT GTTCATCAGG GCACTTCATG
AAAAGGAACG GAGGAGCAAA GGCGGCATGA CACGCACCCA GTTCTTCTTG GTAGCATTTG TGTGCAGCTT TGCCTACTAC
ATTTTCCCAG GCTACCTATT CCAGATGCTC ACTTCCCTCT CCTGGATTTG TTGGATCTTT CCCAAATCTG TGCTCGCACA
ACAGCTTGGA TCAGGTCTCC ATGGCCTTGG CATTGGTGCA ATTGGACTCG ACTGGTCATC CATCTCGTCA TATCTCGGAA
GCCCACTGGC TAGCCCATGG TTTGCCACTG CCAACATTGC TGCCGGCTTC TTCATCTACA TTTATGTAAT CACACCAATC
GCCTACTGGA TTAATCTCTA CAAGGCACAA AACTTCCCTA TCTTTTCAGA TGGCCTTTTC ACAGTGACTG GACAGAAGTA
CAACATCTCT ACCATTATAG ACTCACAGTT TCATTTTGAT ACAAAAGCCT ATGAGAAGAA TGGACCATTA TACATCAGCA
CCTTCTTTTC TATCAGCTAT GGTCTTGGTT TTGCATGTCT TACTGCAACA GTTGTCCACG TTCTTCTTTT CCATGGAAGG
TATCCTCCCC TTCCTTCTCC CTCTAGGTCT ATTATGTAAA ATTAGATACA CAGATAAATT TGTGACACCT GTGTCCAGTG
AAATTTGGCA GCTAAGCAGA TCAGCTTTTC AAGATAAAAA GATGGACATA CATACAAAGC TTATGAAGAG GTACAAACAG
GTTCCTGAAT GGTGGTTCAT CTCCATCCTT ATAGCCAGTG TTGCAATCAC CATGTTCACT TGTGAGTATT ACATAGAACA
ATTGCAGTTA CCCTGGTGGG GGGTACTACT TGCATGTGCC CTTGCAATTT TCTTCACCCT TCCAATTGGA ATCGTCACAG
CAACGACAAA CCAGGTAAGA AGTAAAAGCA TAAAGGCAAA TGCTAATGCA CACATCCAAG TGTAGCACTT CAGCTTATTA
TACTGTATGT GACAGACTCC AGGCTTGAAT ATCATCACGG AATACATCAT GGGGTACTTG TATCCTGGAC GACCTGTCGC
AAACATGTGC TTCAAGGTAT ATGGTTACAT TGGCCCACAG CAAGCCCTAG CATTCCTACA AGATTTTAAG CTGGGACACT
ACATGAAGAT TCCACCAAGG ACCATGTTTA TGGCTCAGGT CAGCTTCACT AGTCACATGA ATAAATGGGT GTATTGCTTG
TAAAAAAGGA GGATAAGCAG ATTATCATTT TATTCAGTGT TGATTATGTC CCTAATAGCA ATTCAAAAAT AGCAGGTGGT
GGGCACTTTG ATAGCAGCAT TTGTGTACCT TGGAACAGCA TGGTGGCTCA TGGATACAAT CCCTAACATA TGCAACACCG
AGCTCCTCCC CCCAGGCAGC CCTTGGACCT GCCCTTATGA TCATTTATTC TATGATGCAT CAGTCATATG GGGCCTTATT
GGCCCACGCA GAATATTTGG TGATTTAGGC ACTTATTCTG CTGTCAACTG GTTCTTCTTG GGGGGTGCCA TTGCTCCCCT
CCTCGTCTGG TTTGCACACA AGGCATTCCC AGGTCAGAAA TGGATCCTAC TTGTCAACAT GCCTGTGCTG ATCGCCGGAA
TCAGCCAGAT GCCTCCTGCC ACTTCAGTCA ACTACACGGC ATGGATATTT GTAGCATTTT TGTCAGGTTA TGTGGTCTAT
AAGTACCGTC GTGACTGGTG GGAGAGACAC AATTATCTAC TTTCAGGTGC CCTTGATGCT GGTTTGGCAT TCATGGCTGT
CTTGCTATAT TTATGCCTAG GACTAGAGAA AATCAGTTTG AACTGGTGGG GTAATGATTT GGATGGTTGT CCATTAGCTT
CTTGCCCCAT TGCGGAAGGT ATAACTGTAC AGGGGTGTCC AGTGGCAAGT GCATAGCCAA GTTTCTTCTC ATCCACAGTA
CCGCCGGCAA TGGTATCTCA ATCATCTTAA GGAGGATGCA AAGATCAAAG AACCATGCAG AGAGGCTTTA AACAACTCAA
AATGAAGACC AAAAAGAAAA TGTCCATATG TTACAAGGAA GATGATACTA CAAGGTGTAC CGAATACAAA AATAAGTAAA
GTTATTTGGT GCATGCTAAA TTGTTGCCGG TGACAGAAAA CAGATTATGA TAATAGATGA ACTGAATTTC TGAAACCAAC
ACTGAATTGA AAGACAGTAG CCATCGTCCA TAGAAATAGT TAAAGTCTGA ACATGATTCC ACTTACCTGT AAAGGTAACA
TCAGGATCAC CTTAGCCTTT AATCATCACA AGAACCTTGC AGGAAAAAGT AAGAAATTCA GATGTTACTT TTGCTTTGAG
GGAAAATGAA ACAATACGGT CAGCATGTAA TCCTGTATGA AACATGGATA ATATAAACTG CATTATATAT TGTTTCATTG
GAAGT

Locus: Os06g0127700

Loading...

Locus: Os06g0127700

Loading...