Os06t0127800-01

Locus

Os06g0127800

Description

GAI-RGA-SCR (GRAS) family protein, Brassinosteroid signaling

RAP-DB Gene Symbol Synonym(s)

DLT, dlt, OsGRAS32, OsDLT

RAP-DB Gene Name Synonym(s)

DWARF AND LOW-TILLERING

CGSNL Gene Symbol

DLT

CGSNL Gene Name

DWARF AND LOW-TILLERING

Oryzabase Gene Symbol Synonym(s)

dlt, OsGRAS32, OsDLT, OsDLT1, DTL1, OsGRAS-32, OsGRAS32, GRAS-32, GRAS32, SMOS2/DLT, SMOS2, OsSMOS2

Oryzabase Gene Name Synonym(s)

GRAS protein 32, SMALL ORGAN SIZE 2

Transcript Evidence

AK106449 (Genbank)

Protein Evidence

Q9LWU9 (UniProt)

Literature

PMID: 15316287

PMID: 19220793

Note

Manual Curation

July 22, 2009

Functional domain (InterPro)

Transcription factor GRAS (IPR005202)

Full-length cDNA

002-103-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0127800-01)

RiceXPro (AK106449)

Others

Oryzabase (8504)

KEGG (Os06t0127800-01)

Transcript

3084 bp

>Os06t0127800-01 GAI-RGA-SCR (GRAS) family protein, Brassinosteroid signaling
GAGTGAGAGTGAGAGAGTGAGAGCAGAGACCACCACCACCGGAGAGGTTAGTGAGAGAGG
AGTGGTAATGGTGAGGCAACAAGAGTAGGTTCCATTTCATATCATCACTAGGATAGCGTA
GTTTGTAGGCTGCATCTCCATCTCCATCGCCATTGATTCGCATTGCATCCATCATTTTAG
GATGTTCTACTAGGGTTCTTGATTTTTCTTTTGGTTTGTTGTTTTGACGAATGGAGGTAT
TGTTGGGATTCGCCGCCTGCTGCTCGTCGTCGTCGTCGCCGATGAGGAGGCCGTGCGGGC
TCTGCCCCGGCATGTCCGATCGTTCGTGATTTGTTTTTTCTACATGTTTTAGGGCCCATT
TGTTCTTGATCCTATTCTTTGATTCTTTTGTACTAAGCATTCTAAGGCGAAGCCACCCAT
TCTTTCCTGCATATATACTTACAAACACATAGCCCCCATCTGATCTCACAAACATTATTT
CTCTCTCTTTTTTTCTCAGTTTTTTCTTTGTTGATTTACTGACCAAATTCTTTGGAAGAA
CAACAAGATCATCTGGTTTTTATCTGCTCATTCTTTTGTACATCGAATCATATACATTTC
CATTCCACCAAAGCCTTAGCCAGATACCACAGAGAGAGTGTGAGAGAAATCAGAGTGAGA
AACAGAGGAGGAAGAAGAAGAAGAAGACGAGGAGGAGGAGGAGGAGGAGCAGGAGGAGGA
GGAGGTCTCTTCTTGGCACGTCGCGTTCCGGCGAGTGACGTGTCTCCGGGATGTTGGCGG
GTTGCTCGTTCTCGTCGTCGAGGCATCAGATGAGCACCGCGCAGCGTTTCGACATCCTCC
CCTGCGGCTTCTCCAAGCGCGGCAGCCGCGGCGACGGCGCCGCCCCGCGGGTCGCCGGCG
ACGCCAGGAGCGGCGCCACCACCTGCTCCTTCCGGACGCACCCCGCGCCGCCGGTCACCC
AGTCCGTGTCCTGGGGCGCCAAGCCGGAGCCCGGCGGCAATGGCAATGGCGCCCACCGCG
CCGTTAAGCGGGCGCATGACGAGGACGCGGTCGAGGAGTATGGCCCCATTGTTCGCGCCA
AGCGGACGCGGATGGGCGGCGACGGCGATGAGGTATGGTTCCATCAATCCATTGCAGGGA
CGATGCAAGCGACGGCGGCGGGAGAAGGAGAGGAGGCGGAGGAGGAGAAGGTCTTCTTGG
TGCCGAGCGCGGCGGCGTTCCCGCACGGCATGGCCGCCGCGGGGCCATCGCTGGCCGCGG
CCAAGAAGGAGGAGTACAGCAAGTCGCCGTCCGACTCGTCGTCCTCGTCGGGCACGGACG
GCGGCTCGTCGGCGATGATGCCGCCGCCGCAGCCGCCCGAGTTCGACGCGAGGAACGGCG
TGCCGGCGCCGGGGCAGGCGGAGCGGGAGGCGCTGGAGCTGGTGCGCgcgctcaccgcgt
gcgccgactccctctccgccggcaaccacgaggccgccaactactacctggcccggctcg
gcgagatggcctcgccggcggggcccacgccgatgcaccgcgtggccgcCTACTTCACCG
AGGCGCTCGCGCTCCGCGTCGTGCGCATGTGGCCGCACATGTTCGACATCGGCCCGCCGC
GGGAGCTCACCGACGACGCCTTCGGCGGCGGCGACGACGACGCCATGGCGCTGCGGATAC
TCAACGCCATCACGCCCATCCCGAGGTTCCTGCACTTCACGCTCAACGAGCGCCTCCTCC
GCGAGTTCGAGGGGCACGAGCGCGTCCACGTCATCGACTTCGACATCAAGCAGGGGCTCC
AATGGCCGGGCTTGCTCCAGAGCCTGGCCGCGCGGGCGGTGCCTCCGGCgcacgtgcgga
tcaccggagtcggcgagtcgaggcaggagctgcaggagacgggagcgcggctggcgcgcg
tcgccgccgcgctcggcctggcgttcgagttccacgccgtggtcgaccggctcgaggacg
tccgcctgtggatgctccacgtcaagcgcggcgagtgcgtggccgtgaactgcgtcctcg
ccatgcaccgcctgctccgcgacgacgccgcgctgaccgacttcctggggctagcgcGCA
GCACGGGCGCCACCATCCTCCTCCTCGGCGAGCACGAGGGCGGCGGCCTCAACTCGGGGA
GGTGGGAGGCGCGGTTCGCGCGCGCGCTGCGGTACTACGCCGCGGCGTTCGACGCGGTGG
ACGCGGCGGGGCTGCCGGAGGCGAGCCCCGCGAGGGCCAAGGCGGAGGAGATGTTCGCGC
GGGAGATCCGCAACGCGGTGGCGTTCGAGGGCCCCGAGCGGTTCGAGCGCCACGAGAGCT
TCGCCGGGTGGCGGCGGCGCATGGAGGACGGCGGCGGGTTCAAGAACGCCGGCATCGGCG
AGCGCGAGGCGATGCAGGGGCGCATGATCGCGAGGATGTTCGGGCCGGACAAGTACACCG
TGCAGGCGCACGGCGGCGGCGGCAGCGGCGGCGGCGAGGCGCTCACGCTCCGGTGGCTGG
ACCAGCCGCTGTACACCGTGACGGCGTGGACGCCGGCGGGCGACGGCGCGGGAGGCAGCA
CCGTGTCGGCGTCCACAACAGCATCACATTCTCAGCAAAGCTAAGCTGACGATGAATGGT
GATTAGGTGAAGAGAAAGAAAGAACAAAGCCTTTTTTTACAGTGCTTCTTTTGTTAATGA
TGATTAGTTCATACAGTATGACAATTCTTTTATACATTCAGAGAAAAGAAAGAAGAAAGA
AAGGTGTAGTTTTTTGTTTTATAGATTGATAGGTGGAAAGATTCAATTAAATCAAATTCA
ATTCAATTTTTAGATTGTAATTCTTTATAAATATTCTTTTGGCTGTTGAGAGAGAGTCCC
CTGCAAAATGTAGCTGCATGTAGAAGAAAGAAAGCAAAGAAGCAGTAGATAGATTAGCAG
GGGCAGCATCTCTCACAGTCACTATTAGTGTCTCCGGCTGTTATTATACAACATTATTAT
TACAATCAAATTCTTTCATCATTCATTCTACATGTAATCTCTGTTCAGAATCAGAATGAA
ATGAAACATGTGTTATATTTCTCC

CDS

1854 bp

>Os06t0127800-01 GAI-RGA-SCR (GRAS) family protein, Brassinosteroid signaling
ATGTTGGCGGGTTGCTCGTTCTCGTCGTCGAGGCATCAGATGAGCACCGCGCAGCGTTTC
GACATCCTCCCCTGCGGCTTCTCCAAGCGCGGCAGCCGCGGCGACGGCGCCGCCCCGCGG
GTCGCCGGCGACGCCAGGAGCGGCGCCACCACCTGCTCCTTCCGGACGCACCCCGCGCCG
CCGGTCACCCAGTCCGTGTCCTGGGGCGCCAAGCCGGAGCCCGGCGGCAATGGCAATGGC
GCCCACCGCGCCGTTAAGCGGGCGCATGACGAGGACGCGGTCGAGGAGTATGGCCCCATT
GTTCGCGCCAAGCGGACGCGGATGGGCGGCGACGGCGATGAGGTATGGTTCCATCAATCC
ATTGCAGGGACGATGCAAGCGACGGCGGCGGGAGAAGGAGAGGAGGCGGAGGAGGAGAAG
GTCTTCTTGGTGCCGAGCGCGGCGGCGTTCCCGCACGGCATGGCCGCCGCGGGGCCATCG
CTGGCCGCGGCCAAGAAGGAGGAGTACAGCAAGTCGCCGTCCGACTCGTCGTCCTCGTCG
GGCACGGACGGCGGCTCGTCGGCGATGATGCCGCCGCCGCAGCCGCCCGAGTTCGACGCG
AGGAACGGCGTGCCGGCGCCGGGGCAGGCGGAGCGGGAGGCGCTGGAGCTGGTGCGCgcg
ctcaccgcgtgcgccgactccctctccgccggcaaccacgaggccgccaactactacctg
gcccggctcggcgagatggcctcgccggcggggcccacgccgatgcaccgcgtggccgcC
TACTTCACCGAGGCGCTCGCGCTCCGCGTCGTGCGCATGTGGCCGCACATGTTCGACATC
GGCCCGCCGCGGGAGCTCACCGACGACGCCTTCGGCGGCGGCGACGACGACGCCATGGCG
CTGCGGATACTCAACGCCATCACGCCCATCCCGAGGTTCCTGCACTTCACGCTCAACGAG
CGCCTCCTCCGCGAGTTCGAGGGGCACGAGCGCGTCCACGTCATCGACTTCGACATCAAG
CAGGGGCTCCAATGGCCGGGCTTGCTCCAGAGCCTGGCCGCGCGGGCGGTGCCTCCGGCg
cacgtgcggatcaccggagtcggcgagtcgaggcaggagctgcaggagacgggagcgcgg
ctggcgcgcgtcgccgccgcgctcggcctggcgttcgagttccacgccgtggtcgaccgg
ctcgaggacgtccgcctgtggatgctccacgtcaagcgcggcgagtgcgtggccgtgaac
tgcgtcctcgccatgcaccgcctgctccgcgacgacgccgcgctgaccgacttcctgggg
ctagcgcGCAGCACGGGCGCCACCATCCTCCTCCTCGGCGAGCACGAGGGCGGCGGCCTC
AACTCGGGGAGGTGGGAGGCGCGGTTCGCGCGCGCGCTGCGGTACTACGCCGCGGCGTTC
GACGCGGTGGACGCGGCGGGGCTGCCGGAGGCGAGCCCCGCGAGGGCCAAGGCGGAGGAG
ATGTTCGCGCGGGAGATCCGCAACGCGGTGGCGTTCGAGGGCCCCGAGCGGTTCGAGCGC
CACGAGAGCTTCGCCGGGTGGCGGCGGCGCATGGAGGACGGCGGCGGGTTCAAGAACGCC
GGCATCGGCGAGCGCGAGGCGATGCAGGGGCGCATGATCGCGAGGATGTTCGGGCCGGAC
AAGTACACCGTGCAGGCGCACGGCGGCGGCGGCAGCGGCGGCGGCGAGGCGCTCACGCTC
CGGTGGCTGGACCAGCCGCTGTACACCGTGACGGCGTGGACGCCGGCGGGCGACGGCGCG
GGAGGCAGCACCGTGTCGGCGTCCACAACAGCATCACATTCTCAGCAAAGCTAA

Protein

618 aa

>Os06t0127800-01 GAI-RGA-SCR (GRAS) family protein, Brassinosteroid signaling
MLAGCSFSSSRHQMSTAQRFDILPCGFSKRGSRGDGAAPRVAGDARSGATTCSFRTHPAP
PVTQSVSWGAKPEPGGNGNGAHRAVKRAHDEDAVEEYGPIVRAKRTRMGGDGDEVWFHQS
IAGTMQATAAGEGEEAEEEKVFLVPSAAAFPHGMAAAGPSLAAAKKEEYSKSPSDSSSSS
GTDGGSSAMMPPPQPPEFDARNGVPAPGQAEREALELVRALTACADSLSAGNHEAANYYL
ARLGEMASPAGPTPMHRVAAYFTEALALRVVRMWPHMFDIGPPRELTDDAFGGGDDDAMA
LRILNAITPIPRFLHFTLNERLLREFEGHERVHVIDFDIKQGLQWPGLLQSLAARAVPPA
HVRITGVGESRQELQETGARLARVAAALGLAFEFHAVVDRLEDVRLWMLHVKRGECVAVN
CVLAMHRLLRDDAALTDFLGLARSTGATILLLGEHEGGGLNSGRWEARFARALRYYAAAF
DAVDAAGLPEASPARAKAEEMFAREIRNAVAFEGPERFERHESFAGWRRRMEDGGGFKNA
GIGEREAMQGRMIARMFGPDKYTVQAHGGGGSGGGEALTLRWLDQPLYTVTAWTPAGDGA
GGSTVSASTTASHSQQS*

5'UTR

chr06:1467814..1468583 (- strand) : 770 bp

CDS

chr06:1465960..1467813 (- strand) : 1854 bp

3'UTR

chr06:1465500..1465959 (- strand) : 460 bp

FASTA

>Os06t0127800-01 class=Sequence position=chr06:1465500..1468583 (- strand)
GAGTGAGAGT GAGAGAGTGA GAGCAGAGAC CACCACCACC GGAGAGGTTA GTGAGAGAGG AGTGGTAATG GTGAGGCAAC
AAGAGTAGGT TCCATTTCAT ATCATCACTA GGATAGCGTA GTTTGTAGGC TGCATCTCCA TCTCCATCGC CATTGATTCG
CATTGCATCC ATCATTTTAG GATGTTCTAC TAGGGTTCTT GATTTTTCTT TTGGTTTGTT GTTTTGACGA ATGGAGGTAT
TGTTGGGATT CGCCGCCTGC TGCTCGTCGT CGTCGTCGCC GATGAGGAGG CCGTGCGGGC TCTGCCCCGG CATGTCCGAT
CGTTCGTGAT TTGTTTTTTC TACATGTTTT AGGGCCCATT TGTTCTTGAT CCTATTCTTT GATTCTTTTG TACTAAGCAT
TCTAAGGCGA AGCCACCCAT TCTTTCCTGC ATATATACTT ACAAACACAT AGCCCCCATC TGATCTCACA AACATTATTT
CTCTCTCTTT TTTTCTCAGT TTTTTCTTTG TTGATTTACT GACCAAATTC TTTGGAAGAA CAACAAGATC ATCTGGTTTT
TATCTGCTCA TTCTTTTGTA CATCGAATCA TATACATTTC CATTCCACCA AAGCCTTAGC CAGATACCAC AGAGAGAGTG
TGAGAGAAAT CAGAGTGAGA AACAGAGGAG GAAGAAGAAG AAGAAGACGA GGAGGAGGAG GAGGAGGAGC AGGAGGAGGA
GGAGGTCTCT TCTTGGCACG TCGCGTTCCG GCGAGTGACG TGTCTCCGGG ATGTTGGCGG GTTGCTCGTT CTCGTCGTCG
AGGCATCAGA TGAGCACCGC GCAGCGTTTC GACATCCTCC CCTGCGGCTT CTCCAAGCGC GGCAGCCGCG GCGACGGCGC
CGCCCCGCGG GTCGCCGGCG ACGCCAGGAG CGGCGCCACC ACCTGCTCCT TCCGGACGCA CCCCGCGCCG CCGGTCACCC
AGTCCGTGTC CTGGGGCGCC AAGCCGGAGC CCGGCGGCAA TGGCAATGGC GCCCACCGCG CCGTTAAGCG GGCGCATGAC
GAGGACGCGG TCGAGGAGTA TGGCCCCATT GTTCGCGCCA AGCGGACGCG GATGGGCGGC GACGGCGATG AGGTATGGTT
CCATCAATCC ATTGCAGGGA CGATGCAAGC GACGGCGGCG GGAGAAGGAG AGGAGGCGGA GGAGGAGAAG GTCTTCTTGG
TGCCGAGCGC GGCGGCGTTC CCGCACGGCA TGGCCGCCGC GGGGCCATCG CTGGCCGCGG CCAAGAAGGA GGAGTACAGC
AAGTCGCCGT CCGACTCGTC GTCCTCGTCG GGCACGGACG GCGGCTCGTC GGCGATGATG CCGCCGCCGC AGCCGCCCGA
GTTCGACGCG AGGAACGGCG TGCCGGCGCC GGGGCAGGCG GAGCGGGAGG CGCTGGAGCT GGTGCGCgcg ctcaccgcgt
gcgccgactc cctctccgcc ggcaaccacg aggccgccaa ctactacctg gcccggctcg gcgagatggc ctcgccggcg
gggcccacgc cgatgcaccg cgtggccgcC TACTTCACCG AGGCGCTCGC GCTCCGCGTC GTGCGCATGT GGCCGCACAT
GTTCGACATC GGCCCGCCGC GGGAGCTCAC CGACGACGCC TTCGGCGGCG GCGACGACGA CGCCATGGCG CTGCGGATAC
TCAACGCCAT CACGCCCATC CCGAGGTTCC TGCACTTCAC GCTCAACGAG CGCCTCCTCC GCGAGTTCGA GGGGCACGAG
CGCGTCCACG TCATCGACTT CGACATCAAG CAGGGGCTCC AATGGCCGGG CTTGCTCCAG AGCCTGGCCG CGCGGGCGGT
GCCTCCGGCg cacgtgcgga tcaccggagt cggcgagtcg aggcaggagc tgcaggagac gggagcgcgg ctggcgcgcg
tcgccgccgc gctcggcctg gcgttcgagt tccacgccgt ggtcgaccgg ctcgaggacg tccgcctgtg gatgctccac
gtcaagcgcg gcgagtgcgt ggccgtgaac tgcgtcctcg ccatgcaccg cctgctccgc gacgacgccg cgctgaccga
cttcctgggg ctagcgcGCA GCACGGGCGC CACCATCCTC CTCCTCGGCG AGCACGAGGG CGGCGGCCTC AACTCGGGGA
GGTGGGAGGC GCGGTTCGCG CGCGCGCTGC GGTACTACGC CGCGGCGTTC GACGCGGTGG ACGCGGCGGG GCTGCCGGAG
GCGAGCCCCG CGAGGGCCAA GGCGGAGGAG ATGTTCGCGC GGGAGATCCG CAACGCGGTG GCGTTCGAGG GCCCCGAGCG
GTTCGAGCGC CACGAGAGCT TCGCCGGGTG GCGGCGGCGC ATGGAGGACG GCGGCGGGTT CAAGAACGCC GGCATCGGCG
AGCGCGAGGC GATGCAGGGG CGCATGATCG CGAGGATGTT CGGGCCGGAC AAGTACACCG TGCAGGCGCA CGGCGGCGGC
GGCAGCGGCG GCGGCGAGGC GCTCACGCTC CGGTGGCTGG ACCAGCCGCT GTACACCGTG ACGGCGTGGA CGCCGGCGGG
CGACGGCGCG GGAGGCAGCA CCGTGTCGGC GTCCACAACA GCATCACATT CTCAGCAAAG CTAAGCTGAC GATGAATGGT
GATTAGGTGA AGAGAAAGAA AGAACAAAGC CTTTTTTTAC AGTGCTTCTT TTGTTAATGA TGATTAGTTC ATACAGTATG
ACAATTCTTT TATACATTCA GAGAAAAGAA AGAAGAAAGA AAGGTGTAGT TTTTTGTTTT ATAGATTGAT AGGTGGAAAG
ATTCAATTAA ATCAAATTCA ATTCAATTTT TAGATTGTAA TTCTTTATAA ATATTCTTTT GGCTGTTGAG AGAGAGTCCC
CTGCAAAATG TAGCTGCATG TAGAAGAAAG AAAGCAAAGA AGCAGTAGAT AGATTAGCAG GGGCAGCATC TCTCACAGTC
ACTATTAGTG TCTCCGGCTG TTATTATACA ACATTATTAT TACAATCAAA TTCTTTCATC ATTCATTCTA CATGTAATCT
CTGTTCAGAA TCAGAATGAA ATGAAACATG TGTTATATTT CTCC