Os06t0130000-01

Locus

Os06g0130000

Description

AAA-type ATPase, Plant spastin, Defense response, Leaf senescence

RAP-DB Gene Symbol Synonym(s)

LMR, SPL4

RAP-DB Gene Name Synonym(s)

LESION MIMIC RESEMBLING, SPOTTED LEAF4

CGSNL Gene Symbol

LRD6-6

CGSNL Gene Name

LESION RESEMBLING DISEASE 6-6

Oryzabase Gene Symbol Synonym(s)

LMR

Oryzabase Gene Name Synonym(s)

lesion resembling disease 6-6, LESION MIMIC RESEMBLING

Transcript Evidence

AK070084

Protein Evidence

Q658G8

Literature

PMID: 25367283

PMID: 30666263

Note

Manual Curation

February 13, 2019

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

MIT (IPR007330)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

AAA+ ATPase domain (IPR003593)

ATPase, AAA-type, core (IPR003959)

ATPase, AAA-type, conserved site (IPR003960)

Full-length cDNA

J023044D08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0130000-01)

RiceXPro (AK070084)

Others

Oryzabase (21412)

KEGG (Os06t0130000-01 (EC:3.6.4.3))

Transcript

1870 bp

>Os06t0130000-01 AAA-type ATPase, Plant spastin, Defense response, Leaf senescence
AGTGGACGCCCACGCGAATACGCGATCCTCCCCTTCCTCCTCCTCCCCACCAACTCGATC
GCGCGTCGCGGAATCCGGATGCTCCCGGCGGCGCTGCTCGCCGTCGGCGCATGAGCTTCC
TCCGCGCGCTCGCGGACTCCCTGTCGTCGCTGCTGTACTCGGCGGCTGCGAAGGGGGGAG
ACATGGACGGGGCCGCGGCGGCGCCGTCGCCGGCGGCGGTGGTGGGGGAGCGCGTGGCGG
TGAAGCTCAGGGGATACTTCGAGCTGGCCAAGGAGGAGATCGACAAGGCCGTGCGCGCCG
AGGAGTGGGGGCTCCCCGACGACGCCGCCGCGCACTACCGCAACGCGCTCCGCGTCATGC
TCGAGGCCAAGGCCGCCCGCGTCCCGGACGCCGTATCCTCCAGCGAGAGGGGGCAGGTTA
GGGTCTACCAGGAGAAGATCGCAAAGTGGCAGACTCAGGTGGAGGAACGACTCCGGGTGC
TCGGCCAGAGGAGTGGAGCGGCTGCACCAGTGCCAAAGAAGGTTGTTACAAACAATCCTG
TTAATAGGAATGACAGAGCCGCATCAACTAGCTTCCATAGGCCTACTTCGCAGCCTAGCC
CTACCTTTAATAGAGGTGGTCAAGCATCTTCTCATCAGAAGAGTAGCAGTGGAGGTGCCA
AACCTGTGCAAAGAGCTGGTGCAAACTATGATGATAAGCTTGTTGAAATGATAAATACGA
CCATTGTGGATAGAAGTCCTGCTGTTAAATGGGAAGATGTTGCTGGCCTTGACAAGGCAA
AGCAAGCACTCATGGAAATGGTCATTTTACCTACCAAGCGAAGGGATTTGTTTACTGGTC
TTCGGAGGCCTGCTAGAGGGCTTCTTCTCTTTGGTCCCCCGGGGAATGGAAAGACGATGC
TTGCCAAAGCTGTTGCATCAGAATCTGAAGCAACATTTTTTAATGTTTCAGCTTCTTCAC
TGACATCAAAGTGGGTAGGAGAGGCTGAAAAGCTTGTACGGACACTCTTCATGGTCGCTG
TCGATAGACAACCATCTGTAATTTTTATGGATGAGATTGATAGTGTCATGTCAGCAAGGT
TAGCTAATGAGAATGATGCTAGCAGGCGGTTGAAATCTGAATTTCTTATCCAGTTTGATG
GGGTCACTTCAAACCCTGATGATCTTGTTATTGTTATAGGTGCTACCAATAAGCCACAAG
AGCTGGATGATGCTGTTCTCCGTAGACTGGTAAAGAGAATATATGTGCCATTACCTGATC
CAAATGTCCGAAGATTACTGCTGAAAACTCAGCTCAAAGGACAATCATTCAAATTATCCA
GTCATGATCTTGAAAGGCTTGCTGCAGATACTGAAGGATATTCCGGGAGTGATCTGAGAG
CATTGTGTGAGGAAGCTGCCATGATGCCAATCAGAGAGCTTGGTCCACAAAATATTCTCA
CTATAAAAGCAAATCAGTTGCGGCCCCTGAAATACGAAGATTTCAAGAAAGCCATGACTG
TGATTAGGCCAAGCCTGCAGAAGAGCAAGTGGGACGAGCTAGAGAAATGGAACGAAGAAT
TTGGTTCAAGTTGACACTAGACAATGGTGCGCCCTATGCATCAGCAGTTTTAATTTGGCC
AGTATTACCATCTCCTCAACATAACTATTGGTTTGCAAGTGGTCGCGCGCCCATTCAGGC
ATTGATATCCCTTGCCATCTGTAACATGTACATGTACAAGAAAACCCTATATTTCATGAG
CCATTTGAGAGGGGAAGCTAAAGATGAACTCACGGTGTAAATAAACGCCCATAGCTTCAA
CCCGTACCAAAACAGTCATGTAAACAAACACTGCTAAAAATTTACATATACCACTGTTCC
GTTACTTTCT

CDS

1464 bp

>Os06t0130000-01 AAA-type ATPase, Plant spastin, Defense response, Leaf senescence
ATGAGCTTCCTCCGCGCGCTCGCGGACTCCCTGTCGTCGCTGCTGTACTCGGCGGCTGCG
AAGGGGGGAGACATGGACGGGGCCGCGGCGGCGCCGTCGCCGGCGGCGGTGGTGGGGGAG
CGCGTGGCGGTGAAGCTCAGGGGATACTTCGAGCTGGCCAAGGAGGAGATCGACAAGGCC
GTGCGCGCCGAGGAGTGGGGGCTCCCCGACGACGCCGCCGCGCACTACCGCAACGCGCTC
CGCGTCATGCTCGAGGCCAAGGCCGCCCGCGTCCCGGACGCCGTATCCTCCAGCGAGAGG
GGGCAGGTTAGGGTCTACCAGGAGAAGATCGCAAAGTGGCAGACTCAGGTGGAGGAACGA
CTCCGGGTGCTCGGCCAGAGGAGTGGAGCGGCTGCACCAGTGCCAAAGAAGGTTGTTACA
AACAATCCTGTTAATAGGAATGACAGAGCCGCATCAACTAGCTTCCATAGGCCTACTTCG
CAGCCTAGCCCTACCTTTAATAGAGGTGGTCAAGCATCTTCTCATCAGAAGAGTAGCAGT
GGAGGTGCCAAACCTGTGCAAAGAGCTGGTGCAAACTATGATGATAAGCTTGTTGAAATG
ATAAATACGACCATTGTGGATAGAAGTCCTGCTGTTAAATGGGAAGATGTTGCTGGCCTT
GACAAGGCAAAGCAAGCACTCATGGAAATGGTCATTTTACCTACCAAGCGAAGGGATTTG
TTTACTGGTCTTCGGAGGCCTGCTAGAGGGCTTCTTCTCTTTGGTCCCCCGGGGAATGGA
AAGACGATGCTTGCCAAAGCTGTTGCATCAGAATCTGAAGCAACATTTTTTAATGTTTCA
GCTTCTTCACTGACATCAAAGTGGGTAGGAGAGGCTGAAAAGCTTGTACGGACACTCTTC
ATGGTCGCTGTCGATAGACAACCATCTGTAATTTTTATGGATGAGATTGATAGTGTCATG
TCAGCAAGGTTAGCTAATGAGAATGATGCTAGCAGGCGGTTGAAATCTGAATTTCTTATC
CAGTTTGATGGGGTCACTTCAAACCCTGATGATCTTGTTATTGTTATAGGTGCTACCAAT
AAGCCACAAGAGCTGGATGATGCTGTTCTCCGTAGACTGGTAAAGAGAATATATGTGCCA
TTACCTGATCCAAATGTCCGAAGATTACTGCTGAAAACTCAGCTCAAAGGACAATCATTC
AAATTATCCAGTCATGATCTTGAAAGGCTTGCTGCAGATACTGAAGGATATTCCGGGAGT
GATCTGAGAGCATTGTGTGAGGAAGCTGCCATGATGCCAATCAGAGAGCTTGGTCCACAA
AATATTCTCACTATAAAAGCAAATCAGTTGCGGCCCCTGAAATACGAAGATTTCAAGAAA
GCCATGACTGTGATTAGGCCAAGCCTGCAGAAGAGCAAGTGGGACGAGCTAGAGAAATGG
AACGAAGAATTTGGTTCAAGTTGA

Protein

488 aa

>Os06t0130000-01 AAA-type ATPase, Plant spastin, Defense response, Leaf senescence
MSFLRALADSLSSLLYSAAAKGGDMDGAAAAPSPAAVVGERVAVKLRGYFELAKEEIDKA
VRAEEWGLPDDAAAHYRNALRVMLEAKAARVPDAVSSSERGQVRVYQEKIAKWQTQVEER
LRVLGQRSGAAAPVPKKVVTNNPVNRNDRAASTSFHRPTSQPSPTFNRGGQASSHQKSSS
GGAKPVQRAGANYDDKLVEMINTTIVDRSPAVKWEDVAGLDKAKQALMEMVILPTKRRDL
FTGLRRPARGLLLFGPPGNGKTMLAKAVASESEATFFNVSASSLTSKWVGEAEKLVRTLF
MVAVDRQPSVIFMDEIDSVMSARLANENDASRRLKSEFLIQFDGVTSNPDDLVIVIGATN
KPQELDDAVLRRLVKRIYVPLPDPNVRRLLLKTQLKGQSFKLSSHDLERLAADTEGYSGS
DLRALCEEAAMMPIRELGPQNILTIKANQLRPLKYEDFKKAMTVIRPSLQKSKWDELEKW
NEEFGSS*

5'UTR

chr06:1588473..1588582 (+ strand) : 110 bp

CDS

chr06:1588583..1588875 (+ strand) : 293 bp

chr06:1588963..1589054 (+ strand) : 92 bp

chr06:1591519..1591544 (+ strand) : 26 bp

chr06:1592129..1592369 (+ strand) : 241 bp

chr06:1592458..1592553 (+ strand) : 96 bp

chr06:1592638..1592753 (+ strand) : 116 bp

chr06:1592836..1592916 (+ strand) : 81 bp

chr06:1593596..1593719 (+ strand) : 124 bp

chr06:1594221..1594270 (+ strand) : 50 bp

chr06:1594734..1594824 (+ strand) : 91 bp

chr06:1595385..1595420 (+ strand) : 36 bp

chr06:1595501..1595601 (+ strand) : 101 bp

chr06:1595683..1595799 (+ strand) : 117 bp

3'UTR

chr06:1595800..1596095 (+ strand) : 296 bp

FASTA

>Os06t0130000-01 class=Sequence position=chr06:1588473..1596095 (+ strand)
AGTGGACGCC CACGCGAATA CGCGATCCTC CCCTTCCTCC TCCTCCCCAC CAACTCGATC GCGCGTCGCG GAATCCGGAT
GCTCCCGGCG GCGCTGCTCG CCGTCGGCGC ATGAGCTTCC TCCGCGCGCT CGCGGACTCC CTGTCGTCGC TGCTGTACTC
GGCGGCTGCG AAGGGGGGAG ACATGGACGG GGCCGCGGCG GCGCCGTCGC CGGCGGCGGT GGTGGGGGAG CGCGTGGCGG
TGAAGCTCAG GGGATACTTC GAGCTGGCCA AGGAGGAGAT CGACAAGGCC GTGCGCGCCG AGGAGTGGGG GCTCCCCGAC
GACGCCGCCG CGCACTACCG CAACGCGCTC CGCGTCATGC TCGAGGCCAA GGCCGCCCGC GTCCCGGACG CCGTATCCTC
CAGGTCCGTG CGTGCGTGCG CCCTTCCCTT CCCCACTGCG CGGTTAGGGT TTGTGATTGC TGATTGGCGT GAGTGCGTTT
TTGATTGCAG CGAGAGGGGG CAGGTTAGGG TCTACCAGGA GAAGATCGCA AAGTGGCAGA CTCAGGTGGA GGAACGACTC
CGGGTGCTCG GCCAGAGGAG TGGTGAGTCG ATCCACTTCT TTCCCCCCAT CAATTTACCT CCGTCTTATT CGTCTAGAGA
GCAACTACCA CCGAGCTCAT GAAATGTGGT TTCCCAGCCA TGTCCTCCAC TTATTCGTCT AGAGACATTA ACTTGTACTC
CATAGTTTAC TCGTGAACCA TTGCGTGTTG GCAGTGGTGG AGCCAGGATT TCTCGACGCC TAGGGCTCAA ATTGAAGGCT
AAAACTACCC ATGAAAATTT GTACACTGCA GTACGGTAGA AGTATAGTAT AATCCGCCGA TTTTCAATGC TAGCAAACAA
ATCTAGCGCA ATATAGCATA ACATGCAATA TTCATCCAGC CATCATTCAT CTTGTTTGTG AGCTATGTTT TAATTATATA
CATAGCTAAG AAGGCTCAGT CTTAattaac agtgttggca atcaaattag tttagttttt ttaaaaaatc taagatagaa
gagcaacact tggcaacgga aacaaTCGAT TGCTTTTCGC CATCTCATGC CTCATCAATT AATACCGCGA GGAATCATCA
ATTTATACTA TTTATGAGGT TGGTGTGGAT TCATTGGAAG ACTTGATAGA ATGATTTTAT CACTCTGCTC TTCATCTAGG
AAATCAAACA AGATTTCTAA TTGATTAATA GCTACCAAAT GCACAATGAG AATACGGATC GAACATTTGA GAGAAGACCA
ACCTATATTT TAGGAATCAA ACTTTCTTGG GTGCTTGACT TGAGGCCTGA GACTTGAGCA AAGATGCTGG GTTGGGAGAC
GAAGTTGCTG AGGAAGGGGA AACGTCGTTG CTGTTGCTAG CTCGCTGCCG ATGCCGATGC GTGCCGTGGC CATCTATGTG
GCGAGACGAG AGGAGGTGAG GTGAGGGCGA GGCGACGAGC ATCCTGCTGC GTCAATGGCT GTGGTTGGGA GCAGATGCGG
CGCAAGCGCT CGTGTGTCGT GGCTAGGGGG ACGGTGGGAT TGGTGGGGAT TAGGGTTAGT TGCTACTGGG CTGCTATGGG
CTTCCAATTG GGTTGAAGGA CACGAGGCTG AGAATGGCCA CGCATAGGGC TGGGCCATTG GAGTTTGACA AAATCTGAAA
ATATATGGGT ACAAGttagg gatggcaacg gggacatccc cgacggatag tgcccgcccg tcccctcccc cgagcagttg
gaaatccccc gctccccatc cctgtccctg cagtcggggg caatcttcct cccgtccccg cccCAACCGG GGTTCCGGGG
CTCTGACGGG GGCGCGCACC CGAGAGGAAA CACAGTGCAG CACGGTGCAT CAATTTGGGA ATTGAGAGGA GACACAAATA
CAAATTCAGA AAAGTTTGGG AATTTGGGAG TAGAGAGAAT AGATGCACAA GAATTAAGAA AAGGAAATGC TTAGTCATGC
ACCCAGATGA CAAATCCTTT CTTTCTTTCT TTTTTGATAA AGACACACAT CAGATCCATG AATCAGAAGA GAGAAGTTAC
ATGATTCATT CCAATTCCCA AGAGCAAGCT ATGCACCAAT CAAAAGCAGT AGAATCAAAG TTCATGTGGC TGCTGTGCAG
CTCTCACGCT GTGCTTTGCA TCGGCAGGCC GCTACATCGG CGGCGGCTCA GCCCAGGCGC GCAGCGAAGC GACGACGCGG
CCGGTGCCCA AGGCGAACAA CGGCAGAGGG TCAGGACGCG GCGTGGGGCA CAGCCTGGAG TCGTCGCTGC CTCGGTGATG
CATCGATCTA CGCCGGCGTC TGTAGCTTGG GTGTGTGGCG GCGCTTGGGT ACCTAGCCGA GTGACTAAAC GAGCTGTGTT
GTGACctagg gtttctctat ttatatgtgt atctgtccat gtgaattggg cctggatagt tgggcttctg atctctagat
gggctgagga gaggtgcaca tgtgctacac tcgggggctc ggggattcgg ggacgggggc ctagagaacg cccccgaacc
cgccccaccc gacggggctt gcttttgccc gttaacaacc ccatggggag taatatggac ctatttatag cccctaatag
agtttttccc cacggggatt caggattcgg gtccccgttg ccaTCCCTAG TACAAGTCCA CTAAAATTTC TCTCACGAGT
AGGCCTCGGG CCCAAGCTGC CCTAGGCCCA GTTCCGCCCC TGCGTGTTGG TGTTAATTTA GGAATTTACG TATATGATAT
AGATAGAAGC TTAGAACGTC CATTGCTTGT ATGCTTGGAT TAAACAACAA GCAAGTGGGG TGTGTTTTCA GTTACAGGTC
TTAATGTTCT GCTTTTCAGT TTCTATGATA GTTCATACCA ACATAATACA TGGACGCTTG AGTTTCTTTT GTCTTTTGTT
TTGTTAACGT ACATAAACTT GTGCTTGCTT TGGTTTTGTA TTGTAGTTCA CTGGGAGTTA ACTATCTATA TCATCTGATT
TTGCAGGAGC GGCTGCACCA GTGCCAAAGA AGGTATGGAT TTCATTGAAC TGTAGTTGTT AACGTTGTAA TTCTGTCAAA
TTTAGCTTTA ATTGTTTTCC AGGCTGTGAA TCTTAGTGCA TTGGTGTTTG TTTGTTGCAA TTAACATGAG TGCTGCATGC
GAAACTGAAT ATGCAGTAGG GTCAACTCTC TTACTTCTAA ATAAGATGGC ATGTTTTCTA GGTGGAGCGA GCGTGCCTGT
TGGTTTTTTT TCCTTTTGTT CAATAATTGT TTACTCAGCT GTTTATTTTC TACACTTCAC TTCTGACTTA GCCATTCAAG
TGTGATTGCT ATCAATGTAG CCTTTTCTAA TGAGTATTTG TAATTTCAAT AATAAAATTT GAAAATTGAA GTAACTCATG
AAACTTCAAA ATGCAATTAG GTCTCTACTT ATTTGGCTTT GACGGTTTGC TGCTTTAATG ACATGCGTTC AGCAAAATGT
CCAATCTAAG AAAATTAAGT AAGATTGTTT GCAAAGTTAT GTTGAGGTTT TGAACACTGT ATTTTCTTAA CGAGTTACTT
GTGGCAAGCG AATCGATTAT GTATTTTTTT CAATAGCTGT GTATTATATT TTACAGGTTG TTACAAACAA TCCTGTTAAT
AGGAATGACA GAGCCGCATC AACTAGCTTC CATAGGCCTA CTTCGCAGCC TAGCCCTACC TTTAATAGAG GTGGTCAAGC
ATCTTCTCAT CAGAAGAGTA GCAGTGGAGG TGCCAAACCT GTGCAAAGAG CTGGTGCAAA CTATGATGAT AAGCTTGTTG
AAATGATAAA TACGACCATT GTGGATAGAA GTCCTGCTGT TAAATGGGAA GATGTTGGTA GGAAGCTTAT AATTTGTTTT
TCATGCTATG GCAAATAAAA CCTAGTGTTC ATTGTAGTGT TCTTATCCTC TGCTTTGATC TGCAGCTGGC CTTGACAAGG
CAAAGCAAGC ACTCATGGAA ATGGTCATTT TACCTACCAA GCGAAGGGAT TTGTTTACTG GTCTTCGGAG GCCTGCTAGA
GGTAAACATC TTCGCTCTGA TAATTTCTGT TATATACATT GTTTTGTAAT AATAGCCATC TTATGTACAT CATAATATAC
CTTAGGGCTT CTTCTCTTTG GTCCCCCGGG GAATGGAAAG ACGATGCTTG CCAAAGCTGT TGCATCAGAA TCTGAAGCAA
CATTTTTTAA TGTTTCAGCT TCTTCACTGA CATCAAAGTG GGTATGTGGC CATCCCTCCA TACGTTACAT GCTTACACAT
ATTCCCCACT CTGAATCAAG TTTATTCTTT CATTGCAAAA CAGGTAGGAG AGGCTGAAAA GCTTGTACGG ACACTCTTCA
TGGTCGCTGT CGATAGACAA CCATCTGTAA TTTTTATGGA TGAGGTCCTC ATTATAAACC CTTCTTGTAG TGCACTTGTA
GTTAAATTTA TGAAGTATAA ATTGATGTCA ACACAAAATG TTTTCTCGAC TCCATTTTTT TCCTTAGGAG TGTTTTTAGT
GTAGCCCATC AACATGAGTT GGAACCATGT CTATCATCTT TTTGGAATGA AAAAAAAGGA TGTTTCTCTA AATAGTTTGC
TTCTGAGAAC TTCTATCCAT TTAAACCATG TGATTAGAAC ATGTAAATAT ATGTGTTCTG CATCACACGT GTTTTGTGTA
AACTTTCCAC AGAATACCAG AATGTGCTCA TCATAGCATT CTGCTATTAG GCTTACTCTG TTATGCTGTG ATGTTGTCAT
TAAGGCTTCT ATGGTTTCAT GTCACCCCTT TTATTATTTT GAACTTTTGT GATGCTTGCC TGCTGAGGTC ATTTGTTTAA
TACATCGAGA ATATTTTTTT ATTGTTATTG TTGTCCACAA ATTCTACCAG AACGTTAACG TTTGGTTCTA AAGCATTCCT
TTCCATTCAA ATCTATCAAG AAATATAGAT GAATGCAAAG ATGTTATCTG CATATCTGGC TTTCTGTGCT AGCTTAGTCG
GTCTAGGATC TTAATGTGTT TAGCTACTTT ATTTTTATTA TTTTAGATAG TTGCTTATTG CCCATGTTGA CTGCCTTTTA
CAGATTGATA GTGTCATGTC AGCAAGGTTA GCTAATGAGA ATGATGCTAG CAGGCGGTTG AAATCTGAAT TTCTTATCCA
GTTTGATGGG GTCACTTCAA ACCCTGATGA TCTTGTTATT GTTATAGGTT AGCATCACTA TCTTTTTCTA GTTACTTAAT
TGAAGTTAGC TTGTGTTATG ATTGGTTATG GAGAAAATAT TTATTTACTA CTAGTATCGT ATAACTATTT GTCATGGTCA
TATATTACTG AGTGTCCATG TTAAAAGCAT TTCTGAAATA GGGAAAGTAT TTATGACATG CTACTGATTT GTTTCCTGAT
TCAATTCATT TATATAAGAA ATTGTTAAAA GTGTGTTCGG GTGTTGTTAA ATAACTCCAA ACTCATTTTT TTGGTATTAT
TTTTTGTATA CTAGGATACT TCTAAATAGT TTCCAACATT ATCAGCAAAA GTTTGTGATC TTGAGTGATA CAGCTTTCCT
GATTTTAGTG CATGTATGTA GGTCGTTTTC TCACTTAGTG AGTGTATGTT AAAACGAAAA ACAAAAATTC TTTGTCGCCA
ATATTTTTTT ATACTAAGTG TCTTCTTTTA TTACTTGCGT CATCTATTAA TGGAATTTAT TTGTTTAGGT GCTACCAATA
AGCCACAAGA GCTGGATGAT GCTGTTCTCC GTAGACTGGT AAGATTGATA TATATTTGGG ACTACTGCCA CTATTTTGGC
TTCATGTTTC CTGCATTGCA TTTAGGTCTT CAAAATTTCT ATGCAATAGT TTCTGCTGCT TAATGCCTGG TACAAGTTCC
ACCTTTGCCC GTGGGTATTG TGGTACAAGC AATTGGTTAG GAACTGGACT AAAGAAAATG CTATTTTTCA CTGTTTACAA
GCAGGCAGCT TGTTGTGGTA GCCAGGTTCT TTTAGAAAGA AGAGTCTGAG GTGTTATTAC TTATAAATAA TGCATATATC
CATATTCTTG AAAAAAGGCT GAGCACTTAT ATTTTGGTAC ATAATGCAGC TTGTTTATAT AAACCTTTTA CTCCTGAATT
TCTAGTGCTT ATATATTGTA GTAGTATGTA TAGGAGCCAG TAATTTGAAC TAGCTTTGCT CCTTTTTTTG TGAATGCCAT
AACATTTATT CCTATAAACA GGTAAAGAGA ATATATGTGC CATTACCTGA TCCAAATGTC CGAAGATTAC TGCTGAAAAC
TCAGCTCAAA GGACAATCAT TCAAATTATC CAGTAAGTAG CTGCTTCTTT ATTACGTTTT AGGTTTCACA AATGCTCTGT
CTAGTTGTTG TTTAAGGCCT TCTCTTGGTA GCTTCTTTGG ACTACAGCAC TAGTGTTCAT TCCTTCACAG AAGTACATTA
ACCAAAAGTA AAATTTCTTG GAAACAAAAG TTCGCCCTGG ATTACAGTTT ATATATTTGA ATATTTGACT ACTGGAGATC
ATTAAAAAAT GATGTTTTCG CCTCTTCTTT TAATCCTAAC ATGATTGAGT CTATATCACA ATTTAATTTT TCCTAGATGA
TCCCTAAATA GTTTTCAAAA ATCACAGTGA CCTAAATTTG CAATGGCCCC CTTCAAAAGT CACCAACTCT GGATTTTCAT
ACTAAAAGCT TCTTTGGAAA TCAGCCTTTT GTTCCTTACC TGAAACATGG ACTTCTCACT TAGTGATCAC TGCATTGTGG
AAAGACTAGT TCGAAAGAAC TGGGGAATTT CCCAGATTAT TCTGTATGTC TGCATGTCTT TCGGCTTTTG TATATGTAGT
ACCACTCTAA ATCTGGAACT GTCCCCTTTC AGGTCATGAT CTTGAAAGGC TTGCTGCAGA TACTGAAGGT AGTTTTATTT
TTCTGGTATA TTGCCATTCT GATAAGACGA CATATGTGTT ACTTGGTGCT GAAATAAATA TGTTATAGGA TATTCCGGGA
GTGATCTGAG AGCATTGTGT GAGGAAGCTG CCATGATGCC AATCAGAGAG CTTGGTCCAC AAAATATTCT CACTATAAAA
GCAAATCAGG TATTTCGAGT TACATCTTCA TACAGTGTGA GCTTTCTGAA GTGTCCTAAT CATATCCCTC CTTTTCTTAC
TTCATTGTAG TTGCGGCCCC TGAAATACGA AGATTTCAAG AAAGCCATGA CTGTGATTAG GCCAAGCCTG CAGAAGAGCA
AGTGGGACGA GCTAGAGAAA TGGAACGAAG AATTTGGTTC AAGTTGACAC TAGACAATGG TGCGCCCTAT GCATCAGCAG
TTTTAATTTG GCCAGTATTA CCATCTCCTC AACATAACTA TTGGTTTGCA AGTGGTCGCG CGCCCATTCA GGCATTGATA
TCCCTTGCCA TCTGTAACAT GTACATGTAC AAGAAAACCC TATATTTCAT GAGCCATTTG AGAGGGGAAG CTAAAGATGA
ACTCACGGTG TAAATAAACG CCCATAGCTT CAACCCGTAC CAAAACAGTC ATGTAAACAA ACACTGCTAA AAATTTACAT
ATACCACTGT TCCGTTACTT TCT

Locus: Os06g0130000

Loading...

Locus: Os06g0130000

Loading...