Os06t0130000-02

Locus

Os06g0130000

Description

Similar to Tobacco mosaic virus helicase domain-binding protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

LRD6-6

CGSNL Gene Name

LESION RESEMBLING DISEASE 6-6

Oryzabase Gene Symbol Synonym(s)

LMR

Oryzabase Gene Name Synonym(s)

lesion resembling disease 6-6, LESION MIMIC RESEMBLING

Transcript Evidence

AK119321 (DDBJ, Best hit)

Protein Evidence

NP_182074.4 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ATPase, AAA+ type, core (IPR003593)

ATPase, AAA-type, core (IPR003959)

ATPase, AAA-type, conserved site (IPR003960)

MIT (IPR007330)

Full-length cDNA

001-131-A02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0130000-02)

RiceXPro (AK119321)

Others

Oryzabase (21412)

KEGG (Os06t0130000-02 (EC:3.6.4.3))

Transcript

3646 bp

>Os06t0130000-02 Similar to Tobacco mosaic virus helicase domain-binding protein (Fragment).
CTTCCTCCTCCTCCCCACCAACTCGATCGCGCGTCGCGGAATCCGGATGCTCCCGGCGGC
GCTGCTCGCCGTCGGCGCATGAGCTTCCTCCGCGCGCTCGCGGACTCCCTGTCGTCGCTG
CTGTACTCGGCGGCTGCGAAGGGGGGAGACATGGACGGGGCCGCGGCGGCGCCGTCGCCG
GCGGCGGTGGTGGGGGAGCGCGTGGCGGTGAAGCTCAGGGGATACTTCGAGCTGGCCAAG
GAGGAGATCGACAAGGCCGTGCGCGCCGAGGAGTGGGGGCTCCCCGACGACGCCGCCGCG
CACTACCGCAACGCGCTCCGCGTCATGCTCGAGGCCAAGGCCGCCCGCGTCCCGGACGCC
GTATCCTCCAGCGAGAGGGGGCAGGTTAGGGTCTACCAGGAGAAGATCGCAAAGTGGCAG
ACTCAGGTGGAGGAACGACTCCGGGTGCTCGGCCAGAGGAGTGGAGCGGCTGCACCAGTG
CCAAAGAAGGTTGTTACAAACAATCCTGTTAATAGGAATGACAGAGCCGCATCAACTAGC
TTCCATAGGCCTACTTCGCAGCCTAGCCCTACCTTTAATAGAGGTGGTCAAGCATCTTCT
CATCAGAAGAGTAGCAGTGGAGGTGCCAAACCTGTGCAAAGAGCTGGTGCAAACTATGAT
GATAAGCTTGTTGAAATGATAAATACGACCATTGTGGATAGAAGTCCTGCTGTTAAATGG
GAAGATGTTGCTGGCCTTGACAAGGCAAAGCAAGCACTCATGGAAATGGTCATTTTACCT
ACCAAGCGAAGGGATTTGTTTACTGGTCTTCGGAGGCCTGCTAGAGGGCTTCTTCTCTTT
GGTCCCCCGGGGAATGGAAAGACGATGCTTGCCAAAGCTGTTGCATCAGAATCTGAAGCA
ACATTTTTTAATGTTTCAGCTTCTTCACTGACATCAAAGTGGGTAGGAGAGGCTGAAAAG
CTTGTACGGACACTCTTCATGGTCGCTGTCGATAGACAACCATCTGTAATTTTTATGGAT
GAGATTGATAGTGTCATGTCAGCAAGGTTAGCTAATGAGAATGATGCTAGCAGGCGGTTG
AAATCTGAATTTCTTATCCAGTTTGATGGGGTCACTTCAAACCCTGATGATCTTGTTATT
GTTATAGGTGCTACCAATAAGCCACAAGAGCTGGATGATGCTGTTCTCCGTAGACTGGTA
AAGAGAATATATGTGCCATTACCTGATCCAAATGTCCGAAGATTACTGCTGAAAACTCAG
CTCAAAGGACAATCATTCAAATTATCCAGTCATGATCTTGAAAGGCTTGCTGCAGATACT
GAAGGATATTCCGGGAGTGATCTGAGAGCATTGTGTGAGGAAGCTGCCATGATGCCAATC
AGAGAGCTTGGTCCACAAAATATTCTCACTATAAAAGCAAATCAGTTGCGGCCCCTGAAA
TACGAAGATTTCAAGAAAGCCATGACTGTGATTAGGCCAAGCCTGCAGAAGAGCAAGTGG
GACGAGCTAGAGAAATGGAACGAAGAATTTGGTTCAAGTTGACACTAGACAATGGCCTAT
CTGAAAGCCTGAAAAGATCAAATTCTTGAGATGCCATCACAACTGAAACTGAACACACGA
GCGAACCATCAGTTGATGCCCAGAATCCAGATAAGCCATCTCATGATTGGAGAAGAATGA
TTGGTGGTGGCCAATTGGTGAGGCGACGAGGAGCTAATCATGTCCCGGACGAAGCCAGCG
TCGCGATCGCCATGGCAGCAGCAGCAGGTGGACGTTTACTCATCCGCATGGCCCATTTAG
CGCCCCCATTTGCGATTTTTCGCAGCATCACGGAGAAAAGAAAAGAAAAGAAAAGGCGCG
GATGGACGCAATGCATGTGCCGTCGCACAGAGCTGGATCTCGCAGCAGCAGCACCACACC
ACCTATGATGACATGTGAGCTGGGACGAAGTTCACATGCTGGCGAGGGGCCCACCTGTCA
GTGAGTGATTGCAAACCGCCGATATCCGATGACACGCGGCGAGAGtttactgaactcgac
caattacatcaagatgatacaaccgtcctgagaatgcttctgatccctgtatagataaga
AATTGGAGAATTTAGGCTGCAGTGGCAGCTGCGAGCTACTCGTGACGGGTTTGATAAGTA
GATTTGGTTGTCGGGTCGGCTGGTGTCGGTGATGGCGATGGAGGCAGAGGAGGGAGCAGT
GATTTTTAAGTTGGGCGGCCGAGTTAGTTAGGAGGAGTGATGTCCATCCACAGTGTCGCC
AAAGACTTGTTCTTCATGGCCATGTGACAAGGAAGGAAGGAAGCAGATCAGGCTGGGATC
ATCAATGCAATCCTGGCTTAGGATTCTTGTTTTGGTGAGCTGACCACCACTTGACCAGAG
TAATTAAGCCAATTAAGATGGTTATTACTACTACTACAATCACATTCTCTGGTCTCTCTC
CACAGATAGTGATCTGATCTGATCTGATCAGATGCAAAGTTGTTGCTGTAACTGAAAAGC
CATATCTTTTCCTCTCAGCTCTACAGCAGCTATCTTCTGTGCAAGATATTCAGAGAGGGA
ATATGTGTCACTGTGTGGCTTTGGCCTGCAAACGCCTACTAATCCTGGGGAATTGCAGTG
GCAATGGTGAATGGTTCTGATAATCCTGTTTTGTGCTGAGGTGTGGGGCCTGTGGTGAGG
GCCCAGTTGTCTGTGCTCCACTGGTGGGTGGGCCAGGTTACTTGGATCAGAATGTTCCTC
TTCTCCTACATACCCTGGCTGGTGATGATGTGGATCTCAGGTTCAGCAGTTTCAGCACCA
ATTGCAGGTTTATGGTATCATCTTGACGCCATATCCCAATGCCCGAATTTCAAGGGATTC
AGAACATTGCAGGGGAGCCTGAAACCTTCCAAGGAATTGCCATGAGACCCAGAGAAGATG
GTAAAAATTTCTCTCTACTGTTGCAGCAAGCTGGTCCCCTACCACATGCCTCTCTCCTGT
TGCTGCAGCTCTTCACATTGCCAAAAACCGGTGCCATGTAATCGTACCCAGTTCAGTTCA
GATCCACTCAGAGCAATCAGCAATGCAAATGGGCTGGCTGATCTGATCATCTCCATGGTG
TTCTTGGCAGCAAGAAAACGAGAACCAAACCAAGAACAACATGGCAGCAGCAATGGTGTT
CCATGGATGGCATTGCAAATCGATCTCCACAATGGCAGCAGCAACCTTTTGACTAGTCCA
GAATAAGGCACGCAGCTCTTGTCCTCCCATGTCTCCTGGCTGGATGATGCTATTGCTGCC
GCTGCTGCAATTGCTTATTTACCCACTGGTCATGGCATGCATGTATTTTTATGTATGTGA
TGTGTCCCCATGCTCTGTTTGTTACTACACAACAGTTATAAAGGTGCAGCTCCTTTGCAT
ACTTCTGGCAAAAAACTTTCACCCAAAGCAAAAGAAAGAGATTCATCAGCAATGTCATGG
ATTCATTGAAGGCAAAGATTTGATGCATCCTGTTGGCAATTGCTAAACACAACTTAGAGA
GAGAGAGAGAGAATGAGAAAGATAGAGTCTTTGGAATGTTCATATTTGTTTGGTTGTGGT
GTGTCATGTGCATGAATGAATCTGCTGCCTGCTGTATGGCTAGCTG

CDS

1464 bp

>Os06t0130000-02 Similar to Tobacco mosaic virus helicase domain-binding protein (Fragment).
ATGAGCTTCCTCCGCGCGCTCGCGGACTCCCTGTCGTCGCTGCTGTACTCGGCGGCTGCG
AAGGGGGGAGACATGGACGGGGCCGCGGCGGCGCCGTCGCCGGCGGCGGTGGTGGGGGAG
CGCGTGGCGGTGAAGCTCAGGGGATACTTCGAGCTGGCCAAGGAGGAGATCGACAAGGCC
GTGCGCGCCGAGGAGTGGGGGCTCCCCGACGACGCCGCCGCGCACTACCGCAACGCGCTC
CGCGTCATGCTCGAGGCCAAGGCCGCCCGCGTCCCGGACGCCGTATCCTCCAGCGAGAGG
GGGCAGGTTAGGGTCTACCAGGAGAAGATCGCAAAGTGGCAGACTCAGGTGGAGGAACGA
CTCCGGGTGCTCGGCCAGAGGAGTGGAGCGGCTGCACCAGTGCCAAAGAAGGTTGTTACA
AACAATCCTGTTAATAGGAATGACAGAGCCGCATCAACTAGCTTCCATAGGCCTACTTCG
CAGCCTAGCCCTACCTTTAATAGAGGTGGTCAAGCATCTTCTCATCAGAAGAGTAGCAGT
GGAGGTGCCAAACCTGTGCAAAGAGCTGGTGCAAACTATGATGATAAGCTTGTTGAAATG
ATAAATACGACCATTGTGGATAGAAGTCCTGCTGTTAAATGGGAAGATGTTGCTGGCCTT
GACAAGGCAAAGCAAGCACTCATGGAAATGGTCATTTTACCTACCAAGCGAAGGGATTTG
TTTACTGGTCTTCGGAGGCCTGCTAGAGGGCTTCTTCTCTTTGGTCCCCCGGGGAATGGA
AAGACGATGCTTGCCAAAGCTGTTGCATCAGAATCTGAAGCAACATTTTTTAATGTTTCA
GCTTCTTCACTGACATCAAAGTGGGTAGGAGAGGCTGAAAAGCTTGTACGGACACTCTTC
ATGGTCGCTGTCGATAGACAACCATCTGTAATTTTTATGGATGAGATTGATAGTGTCATG
TCAGCAAGGTTAGCTAATGAGAATGATGCTAGCAGGCGGTTGAAATCTGAATTTCTTATC
CAGTTTGATGGGGTCACTTCAAACCCTGATGATCTTGTTATTGTTATAGGTGCTACCAAT
AAGCCACAAGAGCTGGATGATGCTGTTCTCCGTAGACTGGTAAAGAGAATATATGTGCCA
TTACCTGATCCAAATGTCCGAAGATTACTGCTGAAAACTCAGCTCAAAGGACAATCATTC
AAATTATCCAGTCATGATCTTGAAAGGCTTGCTGCAGATACTGAAGGATATTCCGGGAGT
GATCTGAGAGCATTGTGTGAGGAAGCTGCCATGATGCCAATCAGAGAGCTTGGTCCACAA
AATATTCTCACTATAAAAGCAAATCAGTTGCGGCCCCTGAAATACGAAGATTTCAAGAAA
GCCATGACTGTGATTAGGCCAAGCCTGCAGAAGAGCAAGTGGGACGAGCTAGAGAAATGG
AACGAAGAATTTGGTTCAAGTTGA

Protein

488 aa

>Os06t0130000-02 Similar to Tobacco mosaic virus helicase domain-binding protein (Fragment).
MSFLRALADSLSSLLYSAAAKGGDMDGAAAAPSPAAVVGERVAVKLRGYFELAKEEIDKA
VRAEEWGLPDDAAAHYRNALRVMLEAKAARVPDAVSSSERGQVRVYQEKIAKWQTQVEER
LRVLGQRSGAAAPVPKKVVTNNPVNRNDRAASTSFHRPTSQPSPTFNRGGQASSHQKSSS
GGAKPVQRAGANYDDKLVEMINTTIVDRSPAVKWEDVAGLDKAKQALMEMVILPTKRRDL
FTGLRRPARGLLLFGPPGNGKTMLAKAVASESEATFFNVSASSLTSKWVGEAEKLVRTLF
MVAVDRQPSVIFMDEIDSVMSARLANENDASRRLKSEFLIQFDGVTSNPDDLVIVIGATN
KPQELDDAVLRRLVKRIYVPLPDPNVRRLLLKTQLKGQSFKLSSHDLERLAADTEGYSGS
DLRALCEEAAMMPIRELGPQNILTIKANQLRPLKYEDFKKAMTVIRPSLQKSKWDELEKW
NEEFGSS*

5'UTR

chr06:1588505..1588582 (+ strand) : 78 bp

CDS

chr06:1588583..1588875 (+ strand) : 293 bp

chr06:1588963..1589054 (+ strand) : 92 bp

chr06:1591519..1591544 (+ strand) : 26 bp

chr06:1592129..1592369 (+ strand) : 241 bp

chr06:1592458..1592553 (+ strand) : 96 bp

chr06:1592638..1592753 (+ strand) : 116 bp

chr06:1592836..1592916 (+ strand) : 81 bp

chr06:1593596..1593719 (+ strand) : 124 bp

chr06:1594221..1594270 (+ strand) : 50 bp

chr06:1594734..1594824 (+ strand) : 91 bp

chr06:1595385..1595420 (+ strand) : 36 bp

chr06:1595501..1595601 (+ strand) : 101 bp

chr06:1595683..1595799 (+ strand) : 117 bp

3'UTR

chr06:1595800..1595811 (+ strand) : 12 bp

chr06:1596188..1596276 (+ strand) : 89 bp

chr06:1596618..1596901 (+ strand) : 284 bp

chr06:1597017..1597963 (+ strand) : 947 bp

chr06:1601539..1602310 (+ strand) : 772 bp

FASTA

>Os06t0130000-02 class=Sequence position=chr06:1588505..1602310 (+ strand)
CTTCCTCCTC CTCCCCACCA ACTCGATCGC GCGTCGCGGA ATCCGGATGC TCCCGGCGGC GCTGCTCGCC GTCGGCGCAT
GAGCTTCCTC CGCGCGCTCG CGGACTCCCT GTCGTCGCTG CTGTACTCGG CGGCTGCGAA GGGGGGAGAC ATGGACGGGG
CCGCGGCGGC GCCGTCGCCG GCGGCGGTGG TGGGGGAGCG CGTGGCGGTG AAGCTCAGGG GATACTTCGA GCTGGCCAAG
GAGGAGATCG ACAAGGCCGT GCGCGCCGAG GAGTGGGGGC TCCCCGACGA CGCCGCCGCG CACTACCGCA ACGCGCTCCG
CGTCATGCTC GAGGCCAAGG CCGCCCGCGT CCCGGACGCC GTATCCTCCA GGTCCGTGCG TGCGTGCGCC CTTCCCTTCC
CCACTGCGCG GTTAGGGTTT GTGATTGCTG ATTGGCGTGA GTGCGTTTTT GATTGCAGCG AGAGGGGGCA GGTTAGGGTC
TACCAGGAGA AGATCGCAAA GTGGCAGACT CAGGTGGAGG AACGACTCCG GGTGCTCGGC CAGAGGAGTG GTGAGTCGAT
CCACTTCTTT CCCCCCATCA ATTTACCTCC GTCTTATTCG TCTAGAGAGC AACTACCACC GAGCTCATGA AATGTGGTTT
CCCAGCCATG TCCTCCACTT ATTCGTCTAG AGACATTAAC TTGTACTCCA TAGTTTACTC GTGAACCATT GCGTGTTGGC
AGTGGTGGAG CCAGGATTTC TCGACGCCTA GGGCTCAAAT TGAAGGCTAA AACTACCCAT GAAAATTTGT ACACTGCAGT
ACGGTAGAAG TATAGTATAA TCCGCCGATT TTCAATGCTA GCAAACAAAT CTAGCGCAAT ATAGCATAAC ATGCAATATT
CATCCAGCCA TCATTCATCT TGTTTGTGAG CTATGTTTTA ATTATATACA TAGCTAAGAA GGCTCAGTCT TAattaacag
tgttggcaat caaattagtt tagttttttt aaaaaatcta agatagaaga gcaacacttg gcaacggaaa caaTCGATTG
CTTTTCGCCA TCTCATGCCT CATCAATTAA TACCGCGAGG AATCATCAAT TTATACTATT TATGAGGTTG GTGTGGATTC
ATTGGAAGAC TTGATAGAAT GATTTTATCA CTCTGCTCTT CATCTAGGAA ATCAAACAAG ATTTCTAATT GATTAATAGC
TACCAAATGC ACAATGAGAA TACGGATCGA ACATTTGAGA GAAGACCAAC CTATATTTTA GGAATCAAAC TTTCTTGGGT
GCTTGACTTG AGGCCTGAGA CTTGAGCAAA GATGCTGGGT TGGGAGACGA AGTTGCTGAG GAAGGGGAAA CGTCGTTGCT
GTTGCTAGCT CGCTGCCGAT GCCGATGCGT GCCGTGGCCA TCTATGTGGC GAGACGAGAG GAGGTGAGGT GAGGGCGAGG
CGACGAGCAT CCTGCTGCGT CAATGGCTGT GGTTGGGAGC AGATGCGGCG CAAGCGCTCG TGTGTCGTGG CTAGGGGGAC
GGTGGGATTG GTGGGGATTA GGGTTAGTTG CTACTGGGCT GCTATGGGCT TCCAATTGGG TTGAAGGACA CGAGGCTGAG
AATGGCCACG CATAGGGCTG GGCCATTGGA GTTTGACAAA ATCTGAAAAT ATATGGGTAC AAGttaggga tggcaacggg
gacatccccg acggatagtg cccgcccgtc ccctcccccg agcagttgga aatcccccgc tccccatccc tgtccctgca
gtcgggggca atcttcctcc cgtccccgcc cCAACCGGGG TTCCGGGGCT CTGACGGGGG CGCGCACCCG AGAGGAAACA
CAGTGCAGCA CGGTGCATCA ATTTGGGAAT TGAGAGGAGA CACAAATACA AATTCAGAAA AGTTTGGGAA TTTGGGAGTA
GAGAGAATAG ATGCACAAGA ATTAAGAAAA GGAAATGCTT AGTCATGCAC CCAGATGACA AATCCTTTCT TTCTTTCTTT
TTTGATAAAG ACACACATCA GATCCATGAA TCAGAAGAGA GAAGTTACAT GATTCATTCC AATTCCCAAG AGCAAGCTAT
GCACCAATCA AAAGCAGTAG AATCAAAGTT CATGTGGCTG CTGTGCAGCT CTCACGCTGT GCTTTGCATC GGCAGGCCGC
TACATCGGCG GCGGCTCAGC CCAGGCGCGC AGCGAAGCGA CGACGCGGCC GGTGCCCAAG GCGAACAACG GCAGAGGGTC
AGGACGCGGC GTGGGGCACA GCCTGGAGTC GTCGCTGCCT CGGTGATGCA TCGATCTACG CCGGCGTCTG TAGCTTGGGT
GTGTGGCGGC GCTTGGGTAC CTAGCCGAGT GACTAAACGA GCTGTGTTGT GACctagggt ttctctattt atatgtgtat
ctgtccatgt gaattgggcc tggatagttg ggcttctgat ctctagatgg gctgaggaga ggtgcacatg tgctacactc
gggggctcgg ggattcgggg acgggggcct agagaacgcc cccgaacccg ccccacccga cggggcttgc ttttgcccgt
taacaacccc atggggagta atatggacct atttatagcc cctaatagag tttttcccca cggggattca ggattcgggt
ccccgttgcc aTCCCTAGTA CAAGTCCACT AAAATTTCTC TCACGAGTAG GCCTCGGGCC CAAGCTGCCC TAGGCCCAGT
TCCGCCCCTG CGTGTTGGTG TTAATTTAGG AATTTACGTA TATGATATAG ATAGAAGCTT AGAACGTCCA TTGCTTGTAT
GCTTGGATTA AACAACAAGC AAGTGGGGTG TGTTTTCAGT TACAGGTCTT AATGTTCTGC TTTTCAGTTT CTATGATAGT
TCATACCAAC ATAATACATG GACGCTTGAG TTTCTTTTGT CTTTTGTTTT GTTAACGTAC ATAAACTTGT GCTTGCTTTG
GTTTTGTATT GTAGTTCACT GGGAGTTAAC TATCTATATC ATCTGATTTT GCAGGAGCGG CTGCACCAGT GCCAAAGAAG
GTATGGATTT CATTGAACTG TAGTTGTTAA CGTTGTAATT CTGTCAAATT TAGCTTTAAT TGTTTTCCAG GCTGTGAATC
TTAGTGCATT GGTGTTTGTT TGTTGCAATT AACATGAGTG CTGCATGCGA AACTGAATAT GCAGTAGGGT CAACTCTCTT
ACTTCTAAAT AAGATGGCAT GTTTTCTAGG TGGAGCGAGC GTGCCTGTTG GTTTTTTTTC CTTTTGTTCA ATAATTGTTT
ACTCAGCTGT TTATTTTCTA CACTTCACTT CTGACTTAGC CATTCAAGTG TGATTGCTAT CAATGTAGCC TTTTCTAATG
AGTATTTGTA ATTTCAATAA TAAAATTTGA AAATTGAAGT AACTCATGAA ACTTCAAAAT GCAATTAGGT CTCTACTTAT
TTGGCTTTGA CGGTTTGCTG CTTTAATGAC ATGCGTTCAG CAAAATGTCC AATCTAAGAA AATTAAGTAA GATTGTTTGC
AAAGTTATGT TGAGGTTTTG AACACTGTAT TTTCTTAACG AGTTACTTGT GGCAAGCGAA TCGATTATGT ATTTTTTTCA
ATAGCTGTGT ATTATATTTT ACAGGTTGTT ACAAACAATC CTGTTAATAG GAATGACAGA GCCGCATCAA CTAGCTTCCA
TAGGCCTACT TCGCAGCCTA GCCCTACCTT TAATAGAGGT GGTCAAGCAT CTTCTCATCA GAAGAGTAGC AGTGGAGGTG
CCAAACCTGT GCAAAGAGCT GGTGCAAACT ATGATGATAA GCTTGTTGAA ATGATAAATA CGACCATTGT GGATAGAAGT
CCTGCTGTTA AATGGGAAGA TGTTGGTAGG AAGCTTATAA TTTGTTTTTC ATGCTATGGC AAATAAAACC TAGTGTTCAT
TGTAGTGTTC TTATCCTCTG CTTTGATCTG CAGCTGGCCT TGACAAGGCA AAGCAAGCAC TCATGGAAAT GGTCATTTTA
CCTACCAAGC GAAGGGATTT GTTTACTGGT CTTCGGAGGC CTGCTAGAGG TAAACATCTT CGCTCTGATA ATTTCTGTTA
TATACATTGT TTTGTAATAA TAGCCATCTT ATGTACATCA TAATATACCT TAGGGCTTCT TCTCTTTGGT CCCCCGGGGA
ATGGAAAGAC GATGCTTGCC AAAGCTGTTG CATCAGAATC TGAAGCAACA TTTTTTAATG TTTCAGCTTC TTCACTGACA
TCAAAGTGGG TATGTGGCCA TCCCTCCATA CGTTACATGC TTACACATAT TCCCCACTCT GAATCAAGTT TATTCTTTCA
TTGCAAAACA GGTAGGAGAG GCTGAAAAGC TTGTACGGAC ACTCTTCATG GTCGCTGTCG ATAGACAACC ATCTGTAATT
TTTATGGATG AGGTCCTCAT TATAAACCCT TCTTGTAGTG CACTTGTAGT TAAATTTATG AAGTATAAAT TGATGTCAAC
ACAAAATGTT TTCTCGACTC CATTTTTTTC CTTAGGAGTG TTTTTAGTGT AGCCCATCAA CATGAGTTGG AACCATGTCT
ATCATCTTTT TGGAATGAAA AAAAAGGATG TTTCTCTAAA TAGTTTGCTT CTGAGAACTT CTATCCATTT AAACCATGTG
ATTAGAACAT GTAAATATAT GTGTTCTGCA TCACACGTGT TTTGTGTAAA CTTTCCACAG AATACCAGAA TGTGCTCATC
ATAGCATTCT GCTATTAGGC TTACTCTGTT ATGCTGTGAT GTTGTCATTA AGGCTTCTAT GGTTTCATGT CACCCCTTTT
ATTATTTTGA ACTTTTGTGA TGCTTGCCTG CTGAGGTCAT TTGTTTAATA CATCGAGAAT ATTTTTTTAT TGTTATTGTT
GTCCACAAAT TCTACCAGAA CGTTAACGTT TGGTTCTAAA GCATTCCTTT CCATTCAAAT CTATCAAGAA ATATAGATGA
ATGCAAAGAT GTTATCTGCA TATCTGGCTT TCTGTGCTAG CTTAGTCGGT CTAGGATCTT AATGTGTTTA GCTACTTTAT
TTTTATTATT TTAGATAGTT GCTTATTGCC CATGTTGACT GCCTTTTACA GATTGATAGT GTCATGTCAG CAAGGTTAGC
TAATGAGAAT GATGCTAGCA GGCGGTTGAA ATCTGAATTT CTTATCCAGT TTGATGGGGT CACTTCAAAC CCTGATGATC
TTGTTATTGT TATAGGTTAG CATCACTATC TTTTTCTAGT TACTTAATTG AAGTTAGCTT GTGTTATGAT TGGTTATGGA
GAAAATATTT ATTTACTACT AGTATCGTAT AACTATTTGT CATGGTCATA TATTACTGAG TGTCCATGTT AAAAGCATTT
CTGAAATAGG GAAAGTATTT ATGACATGCT ACTGATTTGT TTCCTGATTC AATTCATTTA TATAAGAAAT TGTTAAAAGT
GTGTTCGGGT GTTGTTAAAT AACTCCAAAC TCATTTTTTT GGTATTATTT TTTGTATACT AGGATACTTC TAAATAGTTT
CCAACATTAT CAGCAAAAGT TTGTGATCTT GAGTGATACA GCTTTCCTGA TTTTAGTGCA TGTATGTAGG TCGTTTTCTC
ACTTAGTGAG TGTATGTTAA AACGAAAAAC AAAAATTCTT TGTCGCCAAT ATTTTTTTAT ACTAAGTGTC TTCTTTTATT
ACTTGCGTCA TCTATTAATG GAATTTATTT GTTTAGGTGC TACCAATAAG CCACAAGAGC TGGATGATGC TGTTCTCCGT
AGACTGGTAA GATTGATATA TATTTGGGAC TACTGCCACT ATTTTGGCTT CATGTTTCCT GCATTGCATT TAGGTCTTCA
AAATTTCTAT GCAATAGTTT CTGCTGCTTA ATGCCTGGTA CAAGTTCCAC CTTTGCCCGT GGGTATTGTG GTACAAGCAA
TTGGTTAGGA ACTGGACTAA AGAAAATGCT ATTTTTCACT GTTTACAAGC AGGCAGCTTG TTGTGGTAGC CAGGTTCTTT
TAGAAAGAAG AGTCTGAGGT GTTATTACTT ATAAATAATG CATATATCCA TATTCTTGAA AAAAGGCTGA GCACTTATAT
TTTGGTACAT AATGCAGCTT GTTTATATAA ACCTTTTACT CCTGAATTTC TAGTGCTTAT ATATTGTAGT AGTATGTATA
GGAGCCAGTA ATTTGAACTA GCTTTGCTCC TTTTTTTGTG AATGCCATAA CATTTATTCC TATAAACAGG TAAAGAGAAT
ATATGTGCCA TTACCTGATC CAAATGTCCG AAGATTACTG CTGAAAACTC AGCTCAAAGG ACAATCATTC AAATTATCCA
GTAAGTAGCT GCTTCTTTAT TACGTTTTAG GTTTCACAAA TGCTCTGTCT AGTTGTTGTT TAAGGCCTTC TCTTGGTAGC
TTCTTTGGAC TACAGCACTA GTGTTCATTC CTTCACAGAA GTACATTAAC CAAAAGTAAA ATTTCTTGGA AACAAAAGTT
CGCCCTGGAT TACAGTTTAT ATATTTGAAT ATTTGACTAC TGGAGATCAT TAAAAAATGA TGTTTTCGCC TCTTCTTTTA
ATCCTAACAT GATTGAGTCT ATATCACAAT TTAATTTTTC CTAGATGATC CCTAAATAGT TTTCAAAAAT CACAGTGACC
TAAATTTGCA ATGGCCCCCT TCAAAAGTCA CCAACTCTGG ATTTTCATAC TAAAAGCTTC TTTGGAAATC AGCCTTTTGT
TCCTTACCTG AAACATGGAC TTCTCACTTA GTGATCACTG CATTGTGGAA AGACTAGTTC GAAAGAACTG GGGAATTTCC
CAGATTATTC TGTATGTCTG CATGTCTTTC GGCTTTTGTA TATGTAGTAC CACTCTAAAT CTGGAACTGT CCCCTTTCAG
GTCATGATCT TGAAAGGCTT GCTGCAGATA CTGAAGGTAG TTTTATTTTT CTGGTATATT GCCATTCTGA TAAGACGACA
TATGTGTTAC TTGGTGCTGA AATAAATATG TTATAGGATA TTCCGGGAGT GATCTGAGAG CATTGTGTGA GGAAGCTGCC
ATGATGCCAA TCAGAGAGCT TGGTCCACAA AATATTCTCA CTATAAAAGC AAATCAGGTA TTTCGAGTTA CATCTTCATA
CAGTGTGAGC TTTCTGAAGT GTCCTAATCA TATCCCTCCT TTTCTTACTT CATTGTAGTT GCGGCCCCTG AAATACGAAG
ATTTCAAGAA AGCCATGACT GTGATTAGGC CAAGCCTGCA GAAGAGCAAG TGGGACGAGC TAGAGAAATG GAACGAAGAA
TTTGGTTCAA GTTGACACTA GACAATGGTG CGCCCTATGC ATCAGCAGTT TTAATTTGGC CAGTATTACC ATCTCCTCAA
CATAACTATT GGTTTGCAAG TGGTCGCGCG CCCATTCAGG CATTGATATC CCTTGCCATC TGTAACATGT ACATGTACAA
GAAAACCCTA TATTTCATGA GCCATTTGAG AGGGGAAGCT AAAGATGAAC TCACGGTGTA AATAAACGCC CATAGCTTCA
ACCCGTACCA AAACAGTCAT GTAAACAAAC ACTGCTAAAA ATTTACATAT ACCACTGTTC CGTTACTTTC TTTGTACCGT
GTGCAGATAC TTTCGAATTC CATGCCATAT ACTGGTATTT CAGTTATCGT CACTTAAACC GAACTCTTTC TGCCCTCTTG
CAGGCCTATC TGAAAGCCTG AAAAGATCAA ATTCTTGAGA TGCCATCACA ACTGAAACTG AACACACGAG CGAACCATCA
GTTGATGCCC AGGTCTATTA AAACCTTTGG CTTTAGTTCT TTTTGAatta tttattggat tgttgaaacg aattatttgc
gctccacgct ttaaaaatgc attttctcaa aaaaaaactt tcttatatta tatattgtat ttcttagatc acttatttta
ggtcatttgt taagtttatt tatcaaaata ttttgtccat ccatataatc aaaatataat caagtagata atctgcagca
acaatatgta caataacctA TTTCAAACTG AGGCAAATAG CTCTACCAAT CCAGAATCAT ATAGCCATTT TTATCAGCTG
ATGCCCAGAT CTAAGCAAGC TCTACAAATC CAGAATCCAG ATAAGCCATC TCATGATTGG AGAAGAATGA TTGGTGGTGG
CCAATTGGTG AGGCGACGAG GAGCTAATCA TGTCCCGGAC GAAGCCAGCG TCGCGATCGC CATGGCAGCA GCAGCAGGTG
GACGTTTACT CATCCGCATG GCCCATTTAG CGCCCCCATT TGCGATTTTT CGCAGCATCA CGGAGAAAAG AAAAGAAAAG
AAAAGGCGCG GATGGACGCA ATGCATGTGC CGTCGCACAG AGCTGGATCT CGCAGCAGCA GCACCACACC ACCTATGGTT
GGTCCACCTC CCCTGTACAT CCTGATCATG AGCATACGAA CTTCACTGTT TCTTATTACC AAGAACCAAG AAACAAATCC
TCATCTCACC ACCGGTATTC GATCGATTGC AGATGACATG TGAGCTGGGA CGAAGTTCAC ATGCTGGCGA GGGGCCCACC
TGTCAGTGAG TGATTGCAAA CCGCCGATAT CCGATGACAC GCGGCGAGAG tttactgaac tcgaccaatt acatcaagat
gatacaaccg tcctgagaat gcttctgatc cctgtataga taagaAATTG GAGAATTTAG GCTGCAGTGG CAGCTGCGAG
CTACTCGTGA CGGGTTTGAT AAGTAGATTT GGTTGTCGGG TCGGCTGGTG TCGGTGATGG CGATGGAGGC AGAGGAGGGA
GCAGTGATTT TTAAGTTGGG CGGCCGAGTT AGTTAGGAGG AGTGATGTCC ATCCACAGTG TCGCCAAAGA CTTGTTCTTC
ATGGCCATGT GACAAGGAAG GAAGGAAGCA GATCAGGCTG GGATCATCAA TGCAATCCTG GCTTAGGATT CTTGTTTTGG
TGAGCTGACC ACCACTTGAC CAGAGTAATT AAGCCAATTA AGATGGTTAT TACTACTACT ACAATCACAT TCTCTGGTCT
CTCTCCACAG ATAGTGATCT GATCTGATCT GATCAGATGC AAAGTTGTTG CTGTAACTGA AAAGCCATAT CTTTTCCTCT
CAGCTCTACA GCAGCTATCT TCTGTGCAAG ATATTCAGAG AGGGAATATG TGTCACTGTG TGGCTTTGGC CTGCAAACGC
CTACTAATCC TGGGGAATTG CAGTGGCAAT GGTGAATGGT TCTGATAATC CTGTTTTGTG CTGAGGTGTG GGGCCTGTGG
TGAGGGCCCA GTTGTCTGTG CTCCACTGGT GGGTGGGCCA GGTTACTTGG ATCAGAATGT TCCTCTTCTC CTACATACCC
TGGCTGGTGA TGATGTGGAT CTCAGGTTCA GCAGTTTCAG CACCAATTGC AGGTTTATGG TATCATCTTG ACGCCATATC
CCAATGCCCG AATTTCAAGG TATATATATT TTGCAGCTTT TCATACAGTA AGTACAGTCA TTAGTCTAGT CTATTTACTT
ACTCCACTAG TTACTATTTT TGCATAGACA AATGAAGTTT AGTGGTAAAA GAACCCATGC TCTTCTGGCA CCTACTCTAA
GAAACTGCAT GCTATCACAT AAAAACCCAT TAGACCTCAA TAATTCTTCA TAAATCATAT ACTCCTAACA AAGAGTACTG
GATAGAGTAT AAAGTTCAGA TATCCATCCA AAATGCAGCA TTTTGTCAAT CTTGAAATTT ATGGAGCATG GACACACACA
TACTCCAAAA ATGCAGCACT CCTATAGGAA GGTGATAGAA GGACCTTTGG TTGGGAGTAG TATAATTAAT AAATAAAGTT
TTCTACCAGC ATACACTCCA CAGTCTACCA CCATACATAT ACGAGTACTA TGCACTGCAG GTTCCCATCC CCCTAAGATG
ATAGCACCAG CTTTTGTTTT GATTGTTCGA CCATGGCCCC ACATGGCAGC CACTTTTCAC ACCTACAAGA AACCTCTCAC
ATCCTTAACT ACAGTACTAC AGTACGGCTA CTCTTCTACA CAAGGGAGGC TATCTCTATT CCATGATGGA TCTAGAAATG
GTGTTCAAAG AAATGCTTCA GTTCAGGAGG CATTGATGGA TGAACGGATG GATGTGGCAT GTGGGTGCCA TTGTGAGTGC
CAAGATGTAT GAGGACTCCT ATCCCATCAC TCTTTTCTCT TTTCCTTGTA CCAATTGAAA TGAAATTGAA AGAAACCTCC
TCTGCTCCCC TCTTCAGGGC CATGcaactg agggcctgtt tgggaaacag tgacttattt taagtccctg tcacatcgga
tgtttataca ctaatttaga gtattaaaca tacactaatt ataaaaccta ttctataacc ttggactaat tcgcgagacg
aatcttttga gtctaattac accatgattt gacaatgtga tgctacagta aacttttcat aattatggat taattaggct
taaaaaattc gtctcgcaga ttagctttca tttatgaaat tagttttttt attagtctat gtttaatact ccaaattagc
gtcaaacatt cgatgtgaca cggactaaga agttttagcc ccatctaaac accccctgag TGAGTGCCGT GCCACAGTCA
TCACAAGAAC CTGCCTAAAA GGAGGTCACT TGTCATGGGA ATAGATCAAC TAATGAGATG CCATTACTAT CAGGCATCCA
GAGAACTAGT AGTGGAGTTA TTTCATTTCA AGGAGGGACA AAAGTTGGTC CTTTATGTAT CTAACATATT AGTCCGGCAG
TTATAAAATA TAATCATTTC CGACTATGTA TCATCGTTAT AAATACTTAT ATTTTGGAAC AGATAGAGTA GAAGTACATC
TTTTATCTTG TTGCAAATTA CAATGTACTA CACATAGAAA ACACAAGAAA CTCATGTTGT ACAAATCAAC ATCAGCTTTC
CCTAACTGAA ATGTATCATC ATAGTGCAAG TGTTTGGCAC ACCCTGATCA GATTAGCTAT AGGCTTAAAG TAAGTAGTTT
TCACCTTGCT GTCCTTACCT CTTGTCACCA GACCAACAAA TACCAGAACT TTTGTTATCT TATCTATCCT CATTTCTGGG
TGTGCCATCA TCATGCTTTG CTCTGCCTTC ACATGGCCTG TGCCCAACAA TAATATGTCC ACTGGACCCA GTAATGGGGC
ATCAGTACCT CTGCCACACA GCCACTGTGC CCTTCTTTTG GCCTCCCCTT TTGCAAACAA ACCCCTCAAC TTCTCAACCA
CATCAACTTT TACCCCTCCC TCCCCTTTCA GTCCTTCCTT TGGCTAGACA TGAAGTAGGT TTGCATTGTC TGCAGAATAG
CTAGGCTGGC ACCTGCCCTT AGCTGTGGTC CATGGTGTTT CTCATTCTCT TTGTTGTACA AATGCTTTAG TTATTATCCA
TGGATAATAT GAAGTTGCAA AAAGAAAAAA GTTTATGTCA TACTCTACAT GCAAGACTGT AGCTCCTTTG GAAACACAGG
GATAGCGAAA ATGTAGCATC TTAAATCATA TGGAtggagc acaggaaaaa cacacgaatc aaaagacaaa tagatacaaa
ggaatttttc cgagaggttg aagctcatgt tgtaattcct ccaaaattcc tataatctga gacaatcgta aggaatttca
aaggaataaa ggaaagtcat tcctattttc caaaggacca tatatgaatt atttccatag gaattcaatt gttcaaaaat
cgtccaaaat tccttagttc caaaggagcc cTAAAAGGAG ATATGGGTTC AGAGGCTTCT AGAGTGTATT CATTCATATT
TTGCTTATGG ATGTTGCTCA AGCCCATCAA TATCCAACTC TGAAGAGTGG GACATGTGTG GAAGCAAAAC ACACATTTGC
ATGCAAAGCA AACATGTGTA TGCCATTGCC AACAACAGCC TCTCTCATGC AGACACACAC ATGTACTACA CTACTACTAC
TACTACCCAT TTCATTTCTT TTTGGATGCT ATATGTTTCT TCCATCATGT CTTCTTCATT AGGAGAGGAG TAAAGGAGGG
CTACCCATCA CGGATTCTAT GATGGGTTCA ATCAATCCAT CCTCACTGCA TGGTCCTAGC TAGCTAGTGT ATGTAGTAGT
AGTAGTATGA TCCATGGGAG TACATACATT AATTGATTAT GAAATGCAAA CAAGTTGAGA GAGGGCTCTA CTGTTCACCT
GCATTATCCA TTGTAGAGTG CACCTACATT ATCAttaggg tgtgtttagt tcaagccaaa attggaagtt tgattgaaat
taaaacgatg tgacggaaaa gctgaaagtt tgtgtgtgta gaaaagtttt gatgtgatgg aaaagctgga agtttgaaga
aaaagtttag aactaaacca ggccttaGTA AAATTCAACT CTCAGAGCAA GAAGGGGGAG AAATGAAAAG AAAGAAAAAT
TAGAAAGAGA ACAATATTAT TATTtttttg gataaaggag gactgttatc caactcagcc aattacatca agttaataca
accgcactga gaacatttcc ggcAATGGCG AAAAAGAGAA CAATAGTAGT ATATACTAAA GCCAATATCT ATTGAGTTCC
CATAGTTTTT TGTGTATAGA AAGAGGGGAG AAACTACTCC TACATGTGTT GGCCTGTTGC TGATTGATGG GACCTGTGAT
CTTGCACAAA TAAGGGTCCT GGATGCATCT GCATACAGCT GTTGCAGGGC AACAGCATTC CTTAACGTAC ACATTGCACT
GTACTCATCT TGCTGAAAAA TATACTCCCA AAAGAAAATA CAGTGCATCT CTGAACATGC ACCCAAAAGA AAATCTACAA
GCTAAGCAAT CATGGCACAT ATGATTGATC AGAGTATATT ATGAAGCTTT AAAGAAACTA ATCATGCATT TGGCTTAATT
TGGTGGATCA CTCACATAGT ATGCATCCTC TTTTTACCTG ATCCTTCTGA AGCAGTGAAA AAACCACCGT GCAGGGATTC
AGAACATTGC AGGGGAGCCT GAAACCTTCC AAGGAATTGC CATGAGACCC AGAGAAGATG GTAAAAATTT CTCTCTACTG
TTGCAGCAAG CTGGTCCCCT ACCACATGCC TCTCTCCTGT TGCTGCAGCT CTTCACATTG CCAAAAACCG GTGCCATGTA
ATCGTACCCA GTTCAGTTCA GATCCACTCA GAGCAATCAG CAATGCAAAT GGGCTGGCTG ATCTGATCAT CTCCATGGTG
TTCTTGGCAG CAAGAAAACG AGAACCAAAC CAAGAACAAC ATGGCAGCAG CAATGGTGTT CCATGGATGG CATTGCAAAT
CGATCTCCAC AATGGCAGCA GCAACCTTTT GACTAGTCCA GAATAAGGCA CGCAGCTCTT GTCCTCCCAT GTCTCCTGGC
TGGATGATGC TATTGCTGCC GCTGCTGCAA TTGCTTATTT ACCCACTGGT CATGGCATGC ATGTATTTTT ATGTATGTGA
TGTGTCCCCA TGCTCTGTTT GTTACTACAC AACAGTTATA AAGGTGCAGC TCCTTTGCAT ACTTCTGGCA AAAAACTTTC
ACCCAAAGCA AAAGAAAGAG ATTCATCAGC AATGTCATGG ATTCATTGAA GGCAAAGATT TGATGCATCC TGTTGGCAAT
TGCTAAACAC AACTTAGAGA GAGAGAGAGA GAATGAGAAA GATAGAGTCT TTGGAATGTT CATATTTGTT TGGTTGTGGT
GTGTCATGTG CATGAATGAA TCTGCTGCCT GCTGTATGGC TAGCTG

Locus: Os06g0130000

Loading...

Locus: Os06g0130000

Loading...