Os06t0130500-01

Locus

Os06g0130500

Description

Similar to Cyclophilin-like protein PPIL3b.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP18-1

CGSNL Gene Name

CYCLOPHILIN 18-1

Oryzabase Gene Symbol Synonym(s)

OsCYP18-1, OsCYP-12

Oryzabase Gene Name Synonym(s)

cyclophilin 18-1, cyclophilin 12

Transcript Evidence

AK105360 (DDBJ, Best hit)

Protein Evidence

A2Y8V7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type (IPR002130)

Cyclophilin-like (IPR015891)

Peptidyl-prolyl cis-trans isomerase, cyclophilin-type, conserved site (IPR020892)

Full-length cDNA

001-119-D02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0130500-01)

RiceXPro (AK105360)

Others

Oryzabase (10054)

KEGG (Os06t0130500-01 (EC:5.2.1.8))

Transcript

726 bp

>Os06t0130500-01 Similar to Cyclophilin-like protein PPIL3b.
GTCTTCCCCAAAGACTCGAGACTTCTCTACGCTTCTCCTCGCCGCCGAAACGAAGCAACC
CGTCGCCTCGCCGCCGCCGCCATGTCGGTGACGCTGCACACGAATCTCGGGGACATCAAG
TGCGAGGTGTTCTGCGACCAGGCGCCGCGGACGGCGGAGAACTTCCTGGCGCTGTGCGCG
AGCGGCTACTACGACGGCACCATCTTCCACCGCAACATCAAGGGGTTCATGATCCAGGGC
GGCGACCCGACGGGCACGGGGAAGGGGGGCACCTCGATCTGGGGGAAGAAGTTCGCCGAC
GAGTTCAGGGAGTCGCTCAAGCACAACGCCCGCGGGGTGATGTCGATGGCGAACAGCGGG
CCCAACACCAACGGGAGCCAGTTCTTCATCACCTACGCCAAGCAGCCTCACCTCAACGGC
CACTACACCGTGTTCGCCAAGGTCATCCATGGATTCGAGGTGCTCGACCTCATGGAGAAG
GCGCAGACGGGGCCCGGCGACCGCCCCCTCGCCGAGATCAGGCTCAACCGCGTCACCATC
CACGCCAACCCTCTCGCCAACTAATCCTATCTACTCCATCTAGTTTAAAATCTTTGGAAT
TCTGATTGCTTTTTTCTGTGTGGATGTGTTGTGTTCTGCTGCTATCTGAATCTTTGTTGC
AAGAACACCGTACAAACTGAGTCTGTAACTGATATCCCAAAAAGTGTTTGGCTTCACGAT
TGATGC

CDS

483 bp

>Os06t0130500-01 Similar to Cyclophilin-like protein PPIL3b.
ATGTCGGTGACGCTGCACACGAATCTCGGGGACATCAAGTGCGAGGTGTTCTGCGACCAG
GCGCCGCGGACGGCGGAGAACTTCCTGGCGCTGTGCGCGAGCGGCTACTACGACGGCACC
ATCTTCCACCGCAACATCAAGGGGTTCATGATCCAGGGCGGCGACCCGACGGGCACGGGG
AAGGGGGGCACCTCGATCTGGGGGAAGAAGTTCGCCGACGAGTTCAGGGAGTCGCTCAAG
CACAACGCCCGCGGGGTGATGTCGATGGCGAACAGCGGGCCCAACACCAACGGGAGCCAG
TTCTTCATCACCTACGCCAAGCAGCCTCACCTCAACGGCCACTACACCGTGTTCGCCAAG
GTCATCCATGGATTCGAGGTGCTCGACCTCATGGAGAAGGCGCAGACGGGGCCCGGCGAC
CGCCCCCTCGCCGAGATCAGGCTCAACCGCGTCACCATCCACGCCAACCCTCTCGCCAAC
TAA

Protein

161 aa

>Os06t0130500-01 Similar to Cyclophilin-like protein PPIL3b.
MSVTLHTNLGDIKCEVFCDQAPRTAENFLALCASGYYDGTIFHRNIKGFMIQGGDPTGTG
KGGTSIWGKKFADEFRESLKHNARGVMSMANSGPNTNGSQFFITYAKQPHLNGHYTVFAK
VIHGFEVLDLMEKAQTGPGDRPLAEIRLNRVTIHANPLAN*

5'UTR

chr06:1635098..1635178 (+ strand) : 81 bp

CDS

chr06:1635179..1635181 (+ strand) : 3 bp

chr06:1635271..1635750 (+ strand) : 480 bp

3'UTR

chr06:1635751..1635912 (+ strand) : 162 bp

FASTA

>Os06t0130500-01 class=Sequence position=chr06:1635098..1635912 (+ strand)
GTCTTCCCCA AAGACTCGAG ACTTCTCTAC GCTTCTCCTC GCCGCCGAAA CGAAGCAACC CGTCGCCTCG CCGCCGCCGC
CATGGTAAGC CCTCGCCGCT CGAATCTCAC TCTCCCTCAC CGGAAAATCT CTTCCCTGTG GCTGACCGGA GGACCGATTG
ATCTCCGCCG CAGTCGGTGA CGCTGCACAC GAATCTCGGG GACATCAAGT GCGAGGTGTT CTGCGACCAG GCGCCGCGGA
CGGCGGAGAA CTTCCTGGCG CTGTGCGCGA GCGGCTACTA CGACGGCACC ATCTTCCACC GCAACATCAA GGGGTTCATG
ATCCAGGGCG GCGACCCGAC GGGCACGGGG AAGGGGGGCA CCTCGATCTG GGGGAAGAAG TTCGCCGACG AGTTCAGGGA
GTCGCTCAAG CACAACGCCC GCGGGGTGAT GTCGATGGCG AACAGCGGGC CCAACACCAA CGGGAGCCAG TTCTTCATCA
CCTACGCCAA GCAGCCTCAC CTCAACGGCC ACTACACCGT GTTCGCCAAG GTCATCCATG GATTCGAGGT GCTCGACCTC
ATGGAGAAGG CGCAGACGGG GCCCGGCGAC CGCCCCCTCG CCGAGATCAG GCTCAACCGC GTCACCATCC ACGCCAACCC
TCTCGCCAAC TAATCCTATC TACTCCATCT AGTTTAAAAT CTTTGGAATT CTGATTGCTT TTTTCTGTGT GGATGTGTTG
TGTTCTGCTG CTATCTGAAT CTTTGTTGCA AGAACACCGT ACAAACTGAG TCTGTAACTG ATATCCCAAA AAGTGTTTGG
CTTCACGATT GATGC

Locus: Os06g0130500

Loading...

Locus: Os06g0130500

Loading...