Os06t0131300-01

Locus

Os06g0131300

Description

Arginine decarboxylase, Chilling stress response

RAP-DB Gene Symbol Synonym(s)

ADC1, OsADC1, ARGDC, ADC, OsAdc1

RAP-DB Gene Name Synonym(s)

ARGININE DECARBODYLASE, Arginine decarboxylase, Arginine decarboxylase 1

CGSNL Gene Symbol

ADC1

CGSNL Gene Name

ARGININE DECARBODYLASE

Oryzabase Gene Symbol Synonym(s)

OsADC1, ARGDC, ADC, OsAdc1

Oryzabase Gene Name Synonym(s)

Arginine decarboxylase, Arginine decarboxylase 1

Transcript Evidence

AY604047 (Yukihikari)

EU220429 (EYI105)

Protein Evidence

Q9SNN0

Literature

PMID: 16769152

PMID: 20082138

Note

Manual Curation

July 1, 2015

Gene Ontology (GO)

Biological Process: arginine catabolic process (GO:0006527)

Biological Process: spermidine biosynthetic process (GO:0008295)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: arginine decarboxylase activity (GO:0008792)

Functional domain (InterPro)

Ornithine/DAP/Arg decarboxylase (IPR000183)

Arginine decarboxylase (IPR002985)

PLP-binding barrel (IPR029066)

Orn/DAP/Arg decarboxylase 2, N-terminal (IPR022644)

Alanine racemase/group IV decarboxylase, C-terminal (IPR009006)

Orn/DAP/Arg decarboxylase 2, C-terminal (IPR022643)

Orn/DAP/Arg decarboxylase 2, pyridoxal-phosphate binding site (IPR022653)

Expression Databases

TENOR (Os06t0131300-00)

Others

Oryzabase (7113)

Transcript

3049 bp

>Os06t0131300-01 Arginine decarboxylase, Chilling stress response
CTCGCATTTCCCATCTCATCTCTCGCTCGCTCGCTCGCTCGCCGCTACGCCTCACGATTC
CGACGACTCCGACGCCGGTAGGGTCATAACACCCTCCTAGACGCCGGCGACGACGAGGGT
GGTTGGGTTGTGGATAGCGGCTGCGACGACGAGGGCGCTCTCCTGACCGCCGGCGTGGGG
TGCCCCAGCTCCACCACCGGCGACGACTCCTCCTCCGCCGCGAGCGCTCCCCCAGCCTGC
TTCTTTTGCGGGGGTAGCCGGGGCTCCGGCCTCGGCGGCTTTCAAAGCCCCCTTCCTCAC
AACAGGATCCAAAATCCCGTCCTAGAGTTCTTCTACCTCCCCTTCCAAAACTTCCTCTTT
TGGCATCCTTGATTCAATTTCCCTTCCCTTTCTTTCTTTCTTTCTTTCTTTCTTTCGATT
TCTTCTTCTTGCTTTAGATTTCTTATCCTTCTTCTTGTTGCTAATCTCGATCGATCCATC
TATCCATCCAAACAACCTCATTCTTTTTTCCTTTGATTTGATTCTTCGCTGCTAACGCCA
CCGAAACAGACAACAGATTTACAGCAAAAGAAAAAAAAAGAAGGAAGGCTAACCTTTTTC
TGTGGATTTTAGCGTTCTCCGGTTTGTGACGAGATGCCTgcgctcgccgtggacgccgct
gcacctgtcgcgcacgccttcgcgtgcgacgcggcgcgcttccccgcgccgctgctgggc
cccgccgccgcggctgcggcggtggcggagaagccggacgcggccgcgtggtcggccgac
ctctcgtccgcgctgTACAACGTGGACGGCTGGGGCGCGCCGTACTTCTTCGTCAACGAC
GACGGCGACGTCGCCGTGCGCCCGCACGGCGCCGCAACCCTGCCCGGGCAGGAGATCGAC
CTCGCCAAGGTGGTGGCCAAGGCCGCCGGCCCGCGCTCCGGCGGCGGGCTCGGCCTGCCG
CTCCCCCTGCTGGTGCGGTTCCCCGACGTGCTCCGCCACCGCGTGGAGGCCCTGAACGCG
GCGTTCGACTACGCCGTGCGCTCCACCGGCTATGGCGGGAGGTACCAGGGCGTGTACCCC
GTCAAGTGCAACCAGGACCGCCACGTCGTGGAGGACATTGTGGAGTTCGGCGAGCCGTTC
CGCTTCGGCCTGGAGGCCGGCTCCAAGCCCGAGCTGCTGCTCGCCATGAGCTGCCTCGCC
GCGCGCGGCAACCCGGACGCCCTGCTCATCTGCAACGGCTACAAGGACGACGAGTACGTC
TCGCTCGCGCTCATCGCGCGCACCATGGGGCTCAACACGGTCATCGTGCTCGAGCAGGAG
GAGGAGCTCGACATTGTGGTCGACGCTAGCCGCCGCCTCGGCGTGCGCCCGGTGGTCGGC
ATGCGCGCCAAGCTGCGCACCAAGCACGCCGGCCACTTCGGCTCCACGTCCGGGGAGAAG
GGCAAGTTCGGCCTCAACGCCGCGCAGATTCTCTCCGTCGTCGCCAAGCTCAAGACCCTT
GGTATGCTCGACTGCCTCCAGCTCCTGCACTTCCACATTGGCTCCCAGATCCCGACCACT
GCTCTGCTCGGCGATGGCGTCGGGGAGGCCGCGCAGATCTACTGCGAGCTCGCCCgcctg
ggcgcggccatgcgcgtcatcgacgttggtggaggcctcggcattgactacgacgggagt
cactcggcgcagaccgacatgtccgtggcatacagcttggaggagtacgcggcggccgtg
gtggccgccgtcggccgcGTCTGTGACCGCAAGGGCGTCGCGCATCCCATCATCTGCAGC
GAGAGCGGCCGCGCGCTGGTGTCGCACCACTCTGTCCTGGTGTTCGAGGCCTTCTCGGCT
TCGGCGCCCGGCCGCATTGACCCGGCCACGGGCTACCTGCTCGACGAGCTCACCGACGAC
TGCCACGCCGACTACCGCAACCTCATGGCCGCCGCGGTGCGCGGCGACTTCGACACCTGC
GCTCTGTACGCCGACCAGCTGAAGCGGCGCTGCGCCGATCAGTTCAAGGACGGCGTTCTT
GGCCTGGAGCACCTCGCCGCGGTGGACAGCCTCTGCGAGATCGTCGCCCGCGGCATGGGC
GCCGCCGAGCCGCCGCGCACGTACCACATCAACCTGTCCGTGTTCACCTCCCTGCCGGAC
ATGTGGGCGATCGGGCAGATGTTCCCGATCATCCCAATCCAGCGCCTCGGTGAGCGCCCT
GCGGTCGACGGCGTCCTCTCCGACCTCACCTGCGACAGCGACGGCAAGGTCGACCACTTC
ATCGGCGGGAGGCACAGCCTGCCGCTGCACGAGCTCCCCGTCCACGGCACCCGCGGCTAC
TACCTCGGCATGTTCCTCGGCGGCGCCTACCAGGAGGCCCTCGGCGGCCTCCACAACCTG
TTCGGCGGGCCGAGCGTGGTGCGCGTGTCGCAGAGCGACGGGCCGCACTGCTTCGCCGTC
ACGCGCGCGGCGGCGGGGCCGTCGTGCGCCGACGTGCTCCGCTCGATGCAGCACGAGCCC
GAGGTGATGTTCGAGGTGCTCAAGCAGAGGACCGACGGCGCCACCGCCGCCGCGCTCGCC
AGGGCGTTCGGCGCAATGCCGTACCTGTCGTTCGACCCGGAGGCCGCGGCGATGGCCAGC
GGGGAGAGCAGCGGCATGAGCAGCGACTCGGAGGGGTCGGCCGCCGGCGCGGCGGAGGAG
GATGACGACGAGTGGGAGTTCATGCGGGGGCTCACCGTGTGACCGAGGCAGCCATCGCCG
GCTTCTTGGTGTTCACGCGAGGAGTTCTTGCACCTCCTTCTCCTCCTCCATTGTACCTGT
CGCACTGAGCAGTCGTCGTCGCCGTCGTGTTCGTCGCCGTCGCCGACGGTAATCTCCACC
CAGTGTGTGGTTGTATCGTGTCATGGTCGTTGTCGTCGGGCGTCTCGTCGCCGTAGTCTC
GCCGGAGTTTCTGGCGCCACCTTTTTATTTCGCAAGCGTCAGTGTCCACTGTTTCGCTCT
CCTTTTGAAATTTCATCAGAGAATAAGATGAGGAACAAATAAGTTTCGT

CDS

2109 bp

>Os06t0131300-01 Arginine decarboxylase, Chilling stress response
ATGCCTgcgctcgccgtggacgccgctgcacctgtcgcgcacgccttcgcgtgcgacgcg
gcgcgcttccccgcgccgctgctgggccccgccgccgcggctgcggcggtggcggagaag
ccggacgcggccgcgtggtcggccgacctctcgtccgcgctgTACAACGTGGACGGCTGG
GGCGCGCCGTACTTCTTCGTCAACGACGACGGCGACGTCGCCGTGCGCCCGCACGGCGCC
GCAACCCTGCCCGGGCAGGAGATCGACCTCGCCAAGGTGGTGGCCAAGGCCGCCGGCCCG
CGCTCCGGCGGCGGGCTCGGCCTGCCGCTCCCCCTGCTGGTGCGGTTCCCCGACGTGCTC
CGCCACCGCGTGGAGGCCCTGAACGCGGCGTTCGACTACGCCGTGCGCTCCACCGGCTAT
GGCGGGAGGTACCAGGGCGTGTACCCCGTCAAGTGCAACCAGGACCGCCACGTCGTGGAG
GACATTGTGGAGTTCGGCGAGCCGTTCCGCTTCGGCCTGGAGGCCGGCTCCAAGCCCGAG
CTGCTGCTCGCCATGAGCTGCCTCGCCGCGCGCGGCAACCCGGACGCCCTGCTCATCTGC
AACGGCTACAAGGACGACGAGTACGTCTCGCTCGCGCTCATCGCGCGCACCATGGGGCTC
AACACGGTCATCGTGCTCGAGCAGGAGGAGGAGCTCGACATTGTGGTCGACGCTAGCCGC
CGCCTCGGCGTGCGCCCGGTGGTCGGCATGCGCGCCAAGCTGCGCACCAAGCACGCCGGC
CACTTCGGCTCCACGTCCGGGGAGAAGGGCAAGTTCGGCCTCAACGCCGCGCAGATTCTC
TCCGTCGTCGCCAAGCTCAAGACCCTTGGTATGCTCGACTGCCTCCAGCTCCTGCACTTC
CACATTGGCTCCCAGATCCCGACCACTGCTCTGCTCGGCGATGGCGTCGGGGAGGCCGCG
CAGATCTACTGCGAGCTCGCCCgcctgggcgcggccatgcgcgtcatcgacgttggtgga
ggcctcggcattgactacgacgggagtcactcggcgcagaccgacatgtccgtggcatac
agcttggaggagtacgcggcggccgtggtggccgccgtcggccgcGTCTGTGACCGCAAG
GGCGTCGCGCATCCCATCATCTGCAGCGAGAGCGGCCGCGCGCTGGTGTCGCACCACTCT
GTCCTGGTGTTCGAGGCCTTCTCGGCTTCGGCGCCCGGCCGCATTGACCCGGCCACGGGC
TACCTGCTCGACGAGCTCACCGACGACTGCCACGCCGACTACCGCAACCTCATGGCCGCC
GCGGTGCGCGGCGACTTCGACACCTGCGCTCTGTACGCCGACCAGCTGAAGCGGCGCTGC
GCCGATCAGTTCAAGGACGGCGTTCTTGGCCTGGAGCACCTCGCCGCGGTGGACAGCCTC
TGCGAGATCGTCGCCCGCGGCATGGGCGCCGCCGAGCCGCCGCGCACGTACCACATCAAC
CTGTCCGTGTTCACCTCCCTGCCGGACATGTGGGCGATCGGGCAGATGTTCCCGATCATC
CCAATCCAGCGCCTCGGTGAGCGCCCTGCGGTCGACGGCGTCCTCTCCGACCTCACCTGC
GACAGCGACGGCAAGGTCGACCACTTCATCGGCGGGAGGCACAGCCTGCCGCTGCACGAG
CTCCCCGTCCACGGCACCCGCGGCTACTACCTCGGCATGTTCCTCGGCGGCGCCTACCAG
GAGGCCCTCGGCGGCCTCCACAACCTGTTCGGCGGGCCGAGCGTGGTGCGCGTGTCGCAG
AGCGACGGGCCGCACTGCTTCGCCGTCACGCGCGCGGCGGCGGGGCCGTCGTGCGCCGAC
GTGCTCCGCTCGATGCAGCACGAGCCCGAGGTGATGTTCGAGGTGCTCAAGCAGAGGACC
GACGGCGCCACCGCCGCCGCGCTCGCCAGGGCGTTCGGCGCAATGCCGTACCTGTCGTTC
GACCCGGAGGCCGCGGCGATGGCCAGCGGGGAGAGCAGCGGCATGAGCAGCGACTCGGAG
GGGTCGGCCGCCGGCGCGGCGGAGGAGGATGACGACGAGTGGGAGTTCATGCGGGGGCTC
ACCGTGTGA

Protein

703 aa

>Os06t0131300-01 Arginine decarboxylase, Chilling stress response
MPALAVDAAAPVAHAFACDAARFPAPLLGPAAAAAAVAEKPDAAAWSADLSSALYNVDGW
GAPYFFVNDDGDVAVRPHGAATLPGQEIDLAKVVAKAAGPRSGGGLGLPLPLLVRFPDVL
RHRVEALNAAFDYAVRSTGYGGRYQGVYPVKCNQDRHVVEDIVEFGEPFRFGLEAGSKPE
LLLAMSCLAARGNPDALLICNGYKDDEYVSLALIARTMGLNTVIVLEQEEELDIVVDASR
RLGVRPVVGMRAKLRTKHAGHFGSTSGEKGKFGLNAAQILSVVAKLKTLGMLDCLQLLHF
HIGSQIPTTALLGDGVGEAAQIYCELARLGAAMRVIDVGGGLGIDYDGSHSAQTDMSVAY
SLEEYAAAVVAAVGRVCDRKGVAHPIICSESGRALVSHHSVLVFEAFSASAPGRIDPATG
YLLDELTDDCHADYRNLMAAAVRGDFDTCALYADQLKRRCADQFKDGVLGLEHLAAVDSL
CEIVARGMGAAEPPRTYHINLSVFTSLPDMWAIGQMFPIIPIQRLGERPAVDGVLSDLTC
DSDGKVDHFIGGRHSLPLHELPVHGTRGYYLGMFLGGAYQEALGGLHNLFGGPSVVRVSQ
SDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQRTDGATAAALARAFGAMPYLSF
DPEAAAMASGESSGMSSDSEGSAAGAAEEDDDEWEFMRGLTV*

5'UTR

chr06:1676774..1677406 (- strand) : 633 bp

CDS

chr06:1674665..1676773 (- strand) : 2109 bp

3'UTR

chr06:1674358..1674664 (- strand) : 307 bp

FASTA

>Os06t0131300-01 class=Sequence position=chr06:1674358..1677406 (- strand)
CTCGCATTTC CCATCTCATC TCTCGCTCGC TCGCTCGCTC GCCGCTACGC CTCACGATTC CGACGACTCC GACGCCGGTA
GGGTCATAAC ACCCTCCTAG ACGCCGGCGA CGACGAGGGT GGTTGGGTTG TGGATAGCGG CTGCGACGAC GAGGGCGCTC
TCCTGACCGC CGGCGTGGGG TGCCCCAGCT CCACCACCGG CGACGACTCC TCCTCCGCCG CGAGCGCTCC CCCAGCCTGC
TTCTTTTGCG GGGGTAGCCG GGGCTCCGGC CTCGGCGGCT TTCAAAGCCC CCTTCCTCAC AACAGGATCC AAAATCCCGT
CCTAGAGTTC TTCTACCTCC CCTTCCAAAA CTTCCTCTTT TGGCATCCTT GATTCAATTT CCCTTCCCTT TCTTTCTTTC
TTTCTTTCTT TCTTTCGATT TCTTCTTCTT GCTTTAGATT TCTTATCCTT CTTCTTGTTG CTAATCTCGA TCGATCCATC
TATCCATCCA AACAACCTCA TTCTTTTTTC CTTTGATTTG ATTCTTCGCT GCTAACGCCA CCGAAACAGA CAACAGATTT
ACAGCAAAAG AAAAAAAAAG AAGGAAGGCT AACCTTTTTC TGTGGATTTT AGCGTTCTCC GGTTTGTGAC GAGATGCCTg
cgctcgccgt ggacgccgct gcacctgtcg cgcacgcctt cgcgtgcgac gcggcgcgct tccccgcgcc gctgctgggc
cccgccgccg cggctgcggc ggtggcggag aagccggacg cggccgcgtg gtcggccgac ctctcgtccg cgctgTACAA
CGTGGACGGC TGGGGCGCGC CGTACTTCTT CGTCAACGAC GACGGCGACG TCGCCGTGCG CCCGCACGGC GCCGCAACCC
TGCCCGGGCA GGAGATCGAC CTCGCCAAGG TGGTGGCCAA GGCCGCCGGC CCGCGCTCCG GCGGCGGGCT CGGCCTGCCG
CTCCCCCTGC TGGTGCGGTT CCCCGACGTG CTCCGCCACC GCGTGGAGGC CCTGAACGCG GCGTTCGACT ACGCCGTGCG
CTCCACCGGC TATGGCGGGA GGTACCAGGG CGTGTACCCC GTCAAGTGCA ACCAGGACCG CCACGTCGTG GAGGACATTG
TGGAGTTCGG CGAGCCGTTC CGCTTCGGCC TGGAGGCCGG CTCCAAGCCC GAGCTGCTGC TCGCCATGAG CTGCCTCGCC
GCGCGCGGCA ACCCGGACGC CCTGCTCATC TGCAACGGCT ACAAGGACGA CGAGTACGTC TCGCTCGCGC TCATCGCGCG
CACCATGGGG CTCAACACGG TCATCGTGCT CGAGCAGGAG GAGGAGCTCG ACATTGTGGT CGACGCTAGC CGCCGCCTCG
GCGTGCGCCC GGTGGTCGGC ATGCGCGCCA AGCTGCGCAC CAAGCACGCC GGCCACTTCG GCTCCACGTC CGGGGAGAAG
GGCAAGTTCG GCCTCAACGC CGCGCAGATT CTCTCCGTCG TCGCCAAGCT CAAGACCCTT GGTATGCTCG ACTGCCTCCA
GCTCCTGCAC TTCCACATTG GCTCCCAGAT CCCGACCACT GCTCTGCTCG GCGATGGCGT CGGGGAGGCC GCGCAGATCT
ACTGCGAGCT CGCCCgcctg ggcgcggcca tgcgcgtcat cgacgttggt ggaggcctcg gcattgacta cgacgggagt
cactcggcgc agaccgacat gtccgtggca tacagcttgg aggagtacgc ggcggccgtg gtggccgccg tcggccgcGT
CTGTGACCGC AAGGGCGTCG CGCATCCCAT CATCTGCAGC GAGAGCGGCC GCGCGCTGGT GTCGCACCAC TCTGTCCTGG
TGTTCGAGGC CTTCTCGGCT TCGGCGCCCG GCCGCATTGA CCCGGCCACG GGCTACCTGC TCGACGAGCT CACCGACGAC
TGCCACGCCG ACTACCGCAA CCTCATGGCC GCCGCGGTGC GCGGCGACTT CGACACCTGC GCTCTGTACG CCGACCAGCT
GAAGCGGCGC TGCGCCGATC AGTTCAAGGA CGGCGTTCTT GGCCTGGAGC ACCTCGCCGC GGTGGACAGC CTCTGCGAGA
TCGTCGCCCG CGGCATGGGC GCCGCCGAGC CGCCGCGCAC GTACCACATC AACCTGTCCG TGTTCACCTC CCTGCCGGAC
ATGTGGGCGA TCGGGCAGAT GTTCCCGATC ATCCCAATCC AGCGCCTCGG TGAGCGCCCT GCGGTCGACG GCGTCCTCTC
CGACCTCACC TGCGACAGCG ACGGCAAGGT CGACCACTTC ATCGGCGGGA GGCACAGCCT GCCGCTGCAC GAGCTCCCCG
TCCACGGCAC CCGCGGCTAC TACCTCGGCA TGTTCCTCGG CGGCGCCTAC CAGGAGGCCC TCGGCGGCCT CCACAACCTG
TTCGGCGGGC CGAGCGTGGT GCGCGTGTCG CAGAGCGACG GGCCGCACTG CTTCGCCGTC ACGCGCGCGG CGGCGGGGCC
GTCGTGCGCC GACGTGCTCC GCTCGATGCA GCACGAGCCC GAGGTGATGT TCGAGGTGCT CAAGCAGAGG ACCGACGGCG
CCACCGCCGC CGCGCTCGCC AGGGCGTTCG GCGCAATGCC GTACCTGTCG TTCGACCCGG AGGCCGCGGC GATGGCCAGC
GGGGAGAGCA GCGGCATGAG CAGCGACTCG GAGGGGTCGG CCGCCGGCGC GGCGGAGGAG GATGACGACG AGTGGGAGTT
CATGCGGGGG CTCACCGTGT GACCGAGGCA GCCATCGCCG GCTTCTTGGT GTTCACGCGA GGAGTTCTTG CACCTCCTTC
TCCTCCTCCA TTGTACCTGT CGCACTGAGC AGTCGTCGTC GCCGTCGTGT TCGTCGCCGT CGCCGACGGT AATCTCCACC
CAGTGTGTGG TTGTATCGTG TCATGGTCGT TGTCGTCGGG CGTCTCGTCG CCGTAGTCTC GCCGGAGTTT CTGGCGCCAC
CTTTTTATTT CGCAAGCGTC AGTGTCCACT GTTTCGCTCT CCTTTTGAAA TTTCATCAGA GAATAAGATG AGGAACAAAT
AAGTTTCGT

Locus: Os06g0131300

Loading...

Locus: Os06g0131300

Loading...