Os06t0133000-02

Locus

Os06g0133000

Description

Granule-bound starch synthase 1, Starch biosynthesis

RAP-DB Gene Symbol Synonym(s)

WX1, wx (Wx(am)), Wx, WX-B, GBSS-I, GBSS, OsGBSSI, GBSS1, OsGBSS1, GBSSI

RAP-DB Gene Name Synonym(s)

GLUTINOUS ENDOSPERM, glutinous endosperm, waxy, Waxy, WAXY, "Granule-bound starch synthase 1, chloroplastic/amyloplastic", Granule-bound starch synthase I, UDP-glycogen synthase, "Granule-bound starch synthase, chloroplast precursor", glycogen [starch] synthase, Granule-bound glycogen synthase, UDPG-glycogen transglucosylase, uridine diphosphoglucose-glycogen glucosyltransferase, glycogen [starch] synthetase, Granule-bound glycogen [starch] synthase, UDPG-glycogen synthetase, granule bound starch synthase I, granule-bound starch synthase 1, granule-bound starch synthase I

CGSNL Gene Symbol

WX1

CGSNL Gene Name

GLUTINOUS ENDOSPERM

Oryzabase Gene Symbol Synonym(s)

wx (Wx(am)), Wx, WX-B, GBSS-I, GBSS, OsGBSSI, GBSS1, OsGBSS1, GBSSI, GSS, OsWx

Oryzabase Gene Name Synonym(s)

glutinous endosperm, waxy, Waxy, WAXY, "Granule-bound starch synthase 1, chloroplastic/amyloplastic", Granule-bound starch synthase I, UDP-glycogen synthase, "Granule-bound starch synthase, chloroplast precursor", glycogen [starch] synthase, Granule-bound glycogen synthase, UDPG-glycogen transglucosylase, uridine diphosphoglucose-glycogen glucosyltransferase, glycogen [starch] synthetase, Granule-bound glycogen [starch] synthase, UDPG-glycogen synthetase, granule bound starch synthase I, granule-bound starch synthase 1, granule-bound starch synthase I

Transcript Evidence

X62134

Protein Evidence

Q0DEV5

Literature

PMID: 1377969

PMID: 15232694

PMID: 18430767

PMID: 21595523

Note

Manual Curation

March 12, 2010

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Biological Process: glucan biosynthetic process (GO:0009250)

Molecular Function: starch synthase activity (GO:0009011)

Functional domain (InterPro)

Glycogen/starch synthase, ADP-glucose type (IPR011835)

Starch synthase, catalytic domain (IPR013534)

Glycosyl transferase, family 1 (IPR001296)

Others

Oryzabase (744)

Transcript

2534 bp

>Os06t0133000-02 Granule-bound starch synthase 1, Starch biosynthesis
GAATTCAGTGTGAAGGAATAGATTCTCTTCAAAACAATTTAATCATTCATCTGATCTGCT
CAAAGCTCTGTGCATCTCCGGGTGCAACGGCCAGGATATTTATTGTGCAGTAAAAAAATG
TCATATCCCCTAGCCACCCAAGAAACTGCTCCTTAAGTCCTTATAAGCACATATGGCATT
GTAATATATATGTTTGAGTTTTAGCGACAATTTTTTTAAAAACTTTTGGTCCTTTTTATG
AACGTTTTAAGTTTCACTGTCTTTTTTTTTCGAATTTTAAATGTAGCTTCAAATTCTAAT
CCCCAATCCAAATTGTAATAAACTTCAATTCTCCTAATTAACATCTTAATTCATTTATTT
GAAAACCAGTTCAAATTCTTTTAGGCTCACCAAACCTTAAACAATTCAATTCAGTGCAGA
GATCTTCCACAGCAACAGCTAGACAACCACCATGTCGGCTCTCACCACGTCCCAGCTCGC
CACCTCGGCCACCGGCTTCGGCATCGCCGACAGGTCGGCGCCGTCGTCGCTGCTCCGCCA
CGGGTTCCAGGGCCTCAAGCCCCGCAGCCCCGCCGGCGGCGACGCGACGTCGCTCAGCGT
GACGACCAGCGCGCGCGCGACGCCCAAGCAGCAGCGGTCGGTGCAGCGTGGCAGCCGGAG
GTTCCCCTCCGTCGTCGTGTACGCCACCGGCGCCGGCATGAACGTCGTGTTCGTCGGCGC
CGAGATGGCCCCCTGGAGCAAGACCGGCGGCCTCGGTGACGTCCTCGGTGGCCTCCCCCC
TGCCATGGCTGCGAATGGCCACAGGGTCATGGTGATCTCTCCTCGGTACGACCAGTACAA
GGACGCTTGGGATACCAGCGTTGTGGCTGAGATCAAGGTTGCAGACAGGTACGAGAGGGT
GAGGTTTTTCCATTGCTACAAGCGTGGAGTCGACCGTGTGTTCATCGACCATCCGTCATT
CCTGGAGAAGGTTTGGGGAAAGACCGGTGAGAAGATCTACGGACCTGACACTGGAGTTGA
TTACAAAGACAACCAGATGCGTTTCAGCCTTCTTTGCCAGGCAGCACTCGAGGCTCCTAG
GATCCTAAACCTCAACAACAACCCATACTTCAAAGGAACTTATGGTGAGGATGTTGTGTT
CGTCTGCAACGACTGGCACACTGGCCCACTGGCGAGCTACCTGAAGAACAACTACCAGCC
CAATGGCATCTACAGGAATGCAAAGGTTGCTTTCTGCATCCACAACATCTCCTACCAGGG
CCGTTTCGCTTTCGAGGATTACCCTGAGCTGAACCTCTCCGAGAGGTTCAGGTCATCCTT
CGATTTCATCGACGGGTATGACACGCCGGTGGAGGGCAGGAAGATCAACTGGATGAAGGC
CGGAATCCTGGAAGCCGACAGGGTGCTCACCGTGAGCCCGTACTACGCCGAGGAGCTCAT
CTCCGGCATCGCCAGGGGATGCGAGCTCGACAACATCATGCGGCTCACCGGCATCACCGG
CATCGTCAACGGCATGGACGTCAGCGAGTGGGATCCTAGCAAGGACAAGTACATCACCGC
CAAGTACGACGCAACCACGGCAATCGAGGCGAAGGCGCTGAACAAGGAGGCGTtgcaggc
ggaggcgggtcttccggtcgacaggaaaatcccactgatcgcgttcatcggcaggctgga
ggaacagaagggccctgacgtcatggccgccgccatcccggagctcatgcaggaggacgt
ccagatcgttcttctgGGTACTGGAAAGAAGAAGTTCGAGAAGCTGCTCAAGAGCATGGA
GGAGAAGTATCCGGGCAAGGTGAGGGCCGTGGTGAAGTTCAACGCGCCGCTTGCTCATCT
CATCATGGCCGGAGCCGACGTGCTCGCCGTCCCCAGCCGCTTCGAGCCCTGTGGACTCAT
CCAGCTGCAGGGGATGAGATACGGAACGCCCTGTGCTTGCGCGTCCACCGGTGGGCTCGT
GGACACGGTCATCGAAGGCAAGACTGGTTTCCACATGGGCCGTCTCAGCGTCGACTGCAA
GGTGGTGGAGCCAAGCGACGTGAAGAAGGTGGCGGCCACCCTGAAGCGCGCCATCAAGGT
CGTCGGCACGCCGGCGTACGAGGAGATGGTCAGGAACTGCATGAACCAGGACCTCTCCTG
GAAGGGGCCTGCGAAGAACTGGGAGAATGTGCTCCTGGGCCTGGGCGTCGCCGGCAGCGC
GCCGGGGATCGAAGGCGACGAGATCGCGCCGCTCGCCAAGGAGAACGTGGCTGCTCCTTG
AAGAGCCTGAGATCTACATATGGAGTGATTAATTAATATAGCAGTATATGGATGAGAGAC
GAATGAACCAGTGGTTTGTTTGTTGTAGTGAATTTGTAGCTATAGCCAATTATATAGGCT
AATAAGTTTGATGTTGTACTCTTCTGGGTGTGCTTAAGTATCTTATCGGACCCTGAATTT
ATGTGTGTGGCTTATTGCCAATAATATTAAGTAATAAAGGGTTTATTATATTATTATATA
TGTTATATTATACT

CDS

1830 bp

>Os06t0133000-02 Granule-bound starch synthase 1, Starch biosynthesis
ATGTCGGCTCTCACCACGTCCCAGCTCGCCACCTCGGCCACCGGCTTCGGCATCGCCGAC
AGGTCGGCGCCGTCGTCGCTGCTCCGCCACGGGTTCCAGGGCCTCAAGCCCCGCAGCCCC
GCCGGCGGCGACGCGACGTCGCTCAGCGTGACGACCAGCGCGCGCGCGACGCCCAAGCAG
CAGCGGTCGGTGCAGCGTGGCAGCCGGAGGTTCCCCTCCGTCGTCGTGTACGCCACCGGC
GCCGGCATGAACGTCGTGTTCGTCGGCGCCGAGATGGCCCCCTGGAGCAAGACCGGCGGC
CTCGGTGACGTCCTCGGTGGCCTCCCCCCTGCCATGGCTGCGAATGGCCACAGGGTCATG
GTGATCTCTCCTCGGTACGACCAGTACAAGGACGCTTGGGATACCAGCGTTGTGGCTGAG
ATCAAGGTTGCAGACAGGTACGAGAGGGTGAGGTTTTTCCATTGCTACAAGCGTGGAGTC
GACCGTGTGTTCATCGACCATCCGTCATTCCTGGAGAAGGTTTGGGGAAAGACCGGTGAG
AAGATCTACGGACCTGACACTGGAGTTGATTACAAAGACAACCAGATGCGTTTCAGCCTT
CTTTGCCAGGCAGCACTCGAGGCTCCTAGGATCCTAAACCTCAACAACAACCCATACTTC
AAAGGAACTTATGGTGAGGATGTTGTGTTCGTCTGCAACGACTGGCACACTGGCCCACTG
GCGAGCTACCTGAAGAACAACTACCAGCCCAATGGCATCTACAGGAATGCAAAGGTTGCT
TTCTGCATCCACAACATCTCCTACCAGGGCCGTTTCGCTTTCGAGGATTACCCTGAGCTG
AACCTCTCCGAGAGGTTCAGGTCATCCTTCGATTTCATCGACGGGTATGACACGCCGGTG
GAGGGCAGGAAGATCAACTGGATGAAGGCCGGAATCCTGGAAGCCGACAGGGTGCTCACC
GTGAGCCCGTACTACGCCGAGGAGCTCATCTCCGGCATCGCCAGGGGATGCGAGCTCGAC
AACATCATGCGGCTCACCGGCATCACCGGCATCGTCAACGGCATGGACGTCAGCGAGTGG
GATCCTAGCAAGGACAAGTACATCACCGCCAAGTACGACGCAACCACGGCAATCGAGGCG
AAGGCGCTGAACAAGGAGGCGTtgcaggcggaggcgggtcttccggtcgacaggaaaatc
ccactgatcgcgttcatcggcaggctggaggaacagaagggccctgacgtcatggccgcc
gccatcccggagctcatgcaggaggacgtccagatcgttcttctgGGTACTGGAAAGAAG
AAGTTCGAGAAGCTGCTCAAGAGCATGGAGGAGAAGTATCCGGGCAAGGTGAGGGCCGTG
GTGAAGTTCAACGCGCCGCTTGCTCATCTCATCATGGCCGGAGCCGACGTGCTCGCCGTC
CCCAGCCGCTTCGAGCCCTGTGGACTCATCCAGCTGCAGGGGATGAGATACGGAACGCCC
TGTGCTTGCGCGTCCACCGGTGGGCTCGTGGACACGGTCATCGAAGGCAAGACTGGTTTC
CACATGGGCCGTCTCAGCGTCGACTGCAAGGTGGTGGAGCCAAGCGACGTGAAGAAGGTG
GCGGCCACCCTGAAGCGCGCCATCAAGGTCGTCGGCACGCCGGCGTACGAGGAGATGGTC
AGGAACTGCATGAACCAGGACCTCTCCTGGAAGGGGCCTGCGAAGAACTGGGAGAATGTG
CTCCTGGGCCTGGGCGTCGCCGGCAGCGCGCCGGGGATCGAAGGCGACGAGATCGCGCCG
CTCGCCAAGGAGAACGTGGCTGCTCCTTGA

Protein

610 aa

>Os06t0133000-02 Granule-bound starch synthase 1, Starch biosynthesis
MSALTTSQLATSATGFGIADRSAPSSLLRHGFQGLKPRSPAGGDATSLSVTTSARATPKQ
QRSVQRGSRRFPSVVVYATGAGMNVVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVM
VISPRYDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVFIDHPSFLEKVWGKTGE
KIYGPDTGVDYKDNQMRFSLLCQAALEAPRILNLNNNPYFKGTYGEDVVFVCNDWHTGPL
ASYLKNNYQPNGIYRNAKVAFCIHNISYQGRFAFEDYPELNLSERFRSSFDFIDGYDTPV
EGRKINWMKAGILEADRVLTVSPYYAEELISGIARGCELDNIMRLTGITGIVNGMDVSEW
DPSKDKYITAKYDATTAIEAKALNKEALQAEAGLPVDRKIPLIAFIGRLEEQKGPDVMAA
AIPELMQEDVQIVLLGTGKKKFEKLLKSMEEKYPGKVRAVVKFNAPLAHLIMAGADVLAV
PSRFEPCGLIQLQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVDCKVVEPSDVKKV
AATLKRAIKVVGTPAYEEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSAPGIEGDEIAP
LAKENVAAP*

5'UTR

chr06:1766470..1766920 (+ strand) : 451 bp

CDS

chr06:1766921..1767259 (+ strand) : 339 bp

chr06:1767373..1767453 (+ strand) : 81 bp

chr06:1767561..1767659 (+ strand) : 99 bp

chr06:1767756..1767845 (+ strand) : 90 bp

chr06:1767945..1768008 (+ strand) : 64 bp

chr06:1768101..1768201 (+ strand) : 101 bp

chr06:1768292..1768401 (+ strand) : 110 bp

chr06:1768523..1768766 (+ strand) : 244 bp

chr06:1768884..1769060 (+ strand) : 177 bp

chr06:1769304..1769495 (+ strand) : 192 bp

chr06:1769602..1769688 (+ strand) : 87 bp

chr06:1769798..1769926 (+ strand) : 129 bp

chr06:1770284..1770400 (+ strand) : 117 bp

3'UTR

chr06:1770401..1770653 (+ strand) : 253 bp

FASTA

>Os06t0133000-02 class=Sequence position=chr06:1766470..1770653 (+ strand)
GAATTCAGTG TGAAGGAATA GATTCTCTTC AAAACAATTT AATCATTCAT CTGATCTGCT CAAAGCTCTG TGCATCTCCG
GGTGCAACGG CCAGGATATT TATTGTGCAG TAAAAAAATG TCATATCCCC TAGCCACCCA AGAAACTGCT CCTTAAGTCC
TTATAAGCAC ATATGGCATT GTAATATATA TGTTTGAGTT TTAGCGACAA TTTTTTTAAA AACTTTTGGT CCTTTTTATG
AACGTTTTAA GTTTCACTGT CTTTTTTTTT CGAATTTTAA ATGTAGCTTC AAATTCTAAT CCCCAATCCA AATTGTAATA
AACTTCAATT CTCCTAATTA ACATCTTAAT TCATTTATTT GAAAACCAGT TCAAATTCTT TTAGGCTCAC CAAACCTTAA
ACAATTCAAT TCAGTGCAGA GATCTTCCAC AGCAACAGCT AGACAACCAC CATGTCGGCT CTCACCACGT CCCAGCTCGC
CACCTCGGCC ACCGGCTTCG GCATCGCCGA CAGGTCGGCG CCGTCGTCGC TGCTCCGCCA CGGGTTCCAG GGCCTCAAGC
CCCGCAGCCC CGCCGGCGGC GACGCGACGT CGCTCAGCGT GACGACCAGC GCGCGCGCGA CGCCCAAGCA GCAGCGGTCG
GTGCAGCGTG GCAGCCGGAG GTTCCCCTCC GTCGTCGTGT ACGCCACCGG CGCCGGCATG AACGTCGTGT TCGTCGGCGC
CGAGATGGCC CCCTGGAGCA AGACCGGCGG CCTCGGTGAC GTCCTCGGTG GCCTCCCCCC TGCCATGGCT GTAAGCACAC
ACAAACTTCG ATCGCTCGTC GTCGCTGACC GTCGTCGTCT TCAACTGTTC TTGATCATCG CATTGGATGG ATGTGTAATG
TTGTGTTCTT GTGTTCTTTG CAGGCGAATG GCCACAGGGT CATGGTGATC TCTCCTCGGT ACGACCAGTA CAAGGACGCT
TGGGATACCA GCGTTGTGGC TGAGGTAGGA GCATATGCGT GATCAGATCA TCACAAGATC GATTAGCTTT AGATGATTTG
TTACATTTCG CAAGATTTTA ACCCAAGTTT TTGTGGTGCA ATTCATTGCA GATCAAGGTT GCAGACAGGT ACGAGAGGGT
GAGGTTTTTC CATTGCTACA AGCGTGGAGT CGACCGTGTG TTCATCGACC ATCCGTCATT CCTGGAGAAG GTGGAGTCAT
CATTAGTTTA CCTTTTTTGT TTTTACTGAA TTATTAACAG TGCATTTAGC AGTTGGACTG AGCTTAGCTT CCACTGGTGA
TTTCAGGTTT GGGGAAAGAC CGGTGAGAAG ATCTACGGAC CTGACACTGG AGTTGATTAC AAAGACAACC AGATGCGTTT
CAGCCTTCTT TGCCAGGTCA GTGATTACTT CTATCTGATG ATGGTTGGAA GCATCACGAG TTTACCATAG TATGTATGGA
TTCATAACTA ATTCGTGTAT TGATGCTACC TGCAGGCAGC ACTCGAGGCT CCTAGGATCC TAAACCTCAA CAACAACCCA
TACTTCAAAG GAACTTATGG TGAGTTACAA TTGATCTCAA GATCTTATAA CTTTCTTCGA AGGAATCCAT GATGATCAGA
CTAATTCCTT CCGGTTTGTT ACTGACAACA GGTGAGGATG TTGTGTTCGT CTGCAACGAC TGGCACACTG GCCCACTGGC
GAGCTACCTG AAGAACAACT ACCAGCCCAA TGGCATCTAC AGGAATGCAA AGGTCTATGC TTGTTCTTGC CATACCAACT
CAAATCTGCA TGCACACTGC ATTCTGTTCA GAAACTGACT GTCTGAATCT TTTTCACTGC AGGTTGCTTT CTGCATCCAC
AACATCTCCT ACCAGGGCCG TTTCGCTTTC GAGGATTACC CTGAGCTGAA CCTCTCCGAG AGGTTCAGGT CATCCTTCGA
TTTCATCGAC GGGTATGAGT AAGATTCTAA GAGTAACTTA CTGTCAATTC GCCATATATC GATTCAATCC AAGATCCTTT
TGAGCTGACA ACCCTGCACT ACTGTCCATC GTTCAAATCC GGTTAAATTT CAGGTATGAC ACGCCGGTGG AGGGCAGGAA
GATCAACTGG ATGAAGGCCG GAATCCTGGA AGCCGACAGG GTGCTCACCG TGAGCCCGTA CTACGCCGAG GAGCTCATCT
CCGGCATCGC CAGGGGATGC GAGCTCGACA ACATCATGCG GCTCACCGGC ATCACCGGCA TCGTCAACGG CATGGACGTC
AGCGAGTGGG ATCCTAGCAA GGACAAGTAC ATCACCGCCA AGTACGACGC AACCACGGTA AGAACGAATG CATTCTTCAC
AAGATATGCA ATCTGAATTT TCTTTGAAAA AGAAATTATC ATCTGTCACT TCTTGATTGA TTCTGACAAG GCAAGAATGA
GTGACAAATT TCAGGCAATC GAGGCGAAGG CGCTGAACAA GGAGGCGTtg caggcggagg cgggtcttcc ggtcgacagg
aaaatcccac tgatcgcgtt catcggcagg ctggaggaac agaagggccc tgacgtcatg gccgccgcca tcccggagct
catgcaggag gacgtccaga tcgttcttct ggtaTAATAT AATACACTAC AAGACACACT TGCACGATAT GCCAAAAATT
CAGAACAaat tcagtggcaa aaaaaaaact cgaatattag ggaaggacct aataatatca aataattaga aggggtgagg
ctttgaaccc agatcgtcta gtccaccacc ttgtggagtt agccggaaga cctctgagca tttctcaatt cagtggcaaa
tgatgtGTAT AATTTTGATC CGTGTGTGTT TCAGGGTACT GGAAAGAAGA AGTTCGAGAA GCTGCTCAAG AGCATGGAGG
AGAAGTATCC GGGCAAGGTG AGGGCCGTGG TGAAGTTCAA CGCGCCGCTT GCTCATCTCA TCATGGCCGG AGCCGACGTG
CTCGCCGTCC CCAGCCGCTT CGAGCCCTGT GGACTCATCC AGCTGCAGGG GATGAGATAC GGAACGGTAT ACAATTTCCA
TCTATCAATT CGATTGTTCG ATTTCATCTT TGTGCAATGC AATGCAATTG CAAATGCAAA TGCATGATGA TTTTCCTTGT
TGATTTCTCC AGCCCTGTGC TTGCGCGTCC ACCGGTGGGC TCGTGGACAC GGTCATCGAA GGCAAGACTG GTTTCCACAT
GGGCCGTCTC AGCGTCGACG TAAGCCTATA CATTTACATA ACAATCAGAT ATGACACATC CTAATACCGA TAAGTCGGTA
CACTACTACA CATTTACATG GTTGCTGGTT ATATGGTTTT TTTGGCAGTG CAAGGTGGTG GAGCCAAGCG ACGTGAAGAA
GGTGGCGGCC ACCCTGAAGC GCGCCATCAA GGTCGTCGGC ACGCCGGCGT ACGAGGAGAT GGTCAGGAAC TGCATGAACC
AGGACCTCTC CTGGAAGGTA TAAATTACGA AACAAATTTA ACCCAAACAT ATACTATAta ctccctccgc ttctaaatat
tcaacgccgt tgtctttttt aaatatgttt gaccattcgt cttattaaaa aaattaaata attataaatt cttttcctat
catttgattc attgttaaat atacttatat gtatacatat agttttacat atttcataaa attttttgaa caagacgaac
ggtcaaacat gtgctaaaaa gttaacggtg tcgaatattc agaaacggag ggagtaTAAA CGTCTTGTTC AGAAGTTCAG
AGATTCACCT GTCTGATGCT GATGATGATT AATTGTTTGC AACATGGATT TCAGGGGCCT GCGAAGAACT GGGAGAATGT
GCTCCTGGGC CTGGGCGTCG CCGGCAGCGC GCCGGGGATC GAAGGCGACG AGATCGCGCC GCTCGCCAAG GAGAACGTGG
CTGCTCCTTG AAGAGCCTGA GATCTACATA TGGAGTGATT AATTAATATA GCAGTATATG GATGAGAGAC GAATGAACCA
GTGGTTTGTT TGTTGTAGTG AATTTGTAGC TATAGCCAAT TATATAGGCT AATAAGTTTG ATGTTGTACT CTTCTGGGTG
TGCTTAAGTA TCTTATCGGA CCCTGAATTT ATGTGTGTGG CTTATTGCCA ATAATATTAA GTAATAAAGG GTTTATTATA
TTATTATATA TGTTATATTA TACT