Os06t0139000-01

Locus

Os06g0139000

Description

LRR-type F-box protein, Vegetative growth, Floral organ specification

RAP-DB Gene Symbol Synonym(s)

DDF1

RAP-DB Gene Name Synonym(s)

Dwarf and deformed flower 1

CGSNL Gene Symbol

DDF1

CGSNL Gene Name

DWARF AND DEFORMED FLOWER 1

Oryzabase Gene Symbol Synonym(s)

OsDDF1

Oryzabase Gene Name Synonym(s)

Dwarf and deformed flower 1, dwarf and deformed flower 1-1

Transcript Evidence

AK073027

Protein Evidence

Q5VPF9

Literature

PMID: 22897567

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.
  • There might be sequencing error in this region.

Manual Curation

August 5, 2020

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box-like domain superfamily (IPR036047)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023148M09 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0139000-01)

Others

Oryzabase (11536)

Oryzabase (17588)

Transcript

2043 bp

>Os06t0139000-01 LRR-type F-box protein, Vegetative growth, Floral organ specification
GGGCTCCTTCCTAAAATTATAACTCTGATATCTATATCTATCTTGCCTACAAATTATAAC
TCTCGTTCCCCAATTTTGTGTGTGACGTTGAGAAGTGCCGACCGGCGACGACGAAAGGCC
GGCGGAGAGAGATCCCCTCACCACCATGGGGATGCTGGATCTGATGCGCCTCATGTCCAT
CCAGCGCCAGCGGGACCAGGAGCGCCGCCGCCGCCAAGCCCAAGCTCCCCCCCGTGATGG
ATTGATTGCTTTACGGGCTAAAAGAAAAGGGCTCACCCTGCCAACAAGACGGCGATTCTC
AGGGTGCTGCTGACATAGAGATACCAAGCCTTCCAGAGGACATCTGGCGTCTTATACATT
CCTTGATGCCAATGCGGGATGCTGCCCGAGCTGCCTGTGTGTCTCATTCCTTTCTAAGTT
CCTGGAGATGCCACCCCAACCTCAATTTCAGTAGTGAAGCATTGGGGTTGAGCAAAAATG
CATATGGAAACGAAGAATTGGCTGGACTTTTCTACAGCAAAGTCAACCACATTCTCAAAA
GGCACTCAGGCATCGGCGTGAAAAAACTGACGATTAAGGTATATTCAGATTATAGTGGGA
AGGGCTCTTCATATCTCAACAATTGGCTTCAGATTGCTGTTAAACCAGGGATTGAAGAAC
TCATAATTGCACTGACCCAGTTCCAGGCAAAGTACAATTTCCCATGCTCTCTTCTGTCGA
ATGGGAGTGGAGACTCAATCCAATATCTTCACCTTTCTAACTGTTCCTTCCACCCAACAG
TCACACTTAGTGGCTTAAGAAGTCTGACGAGATTGTATCTTTGTCGTGTGCGTATTACCG
AGAACGAGTTAGGCTGCCTTCTTTCCCATTCTCTTGCATTGGAGCAGTTGGAAATCAGGT
ACTGCAATAGGATAGTTTGCCTGAAGGTACCTTGCCTACTGCAACGGCTCATCTCCCTGA
AGGTGTTTGGGTGTGACAAGTTGAAACTGATAGAAAATGAAGCTCCTAATGTCTCCATGT
TTGCATTTCAAGGGGACAAAACGGAACTGAAACTTGGAGAAACTTTGCAAATAAAGAGCC
TATGCATGGTCCGCTCTGGTTATGTTTATCATGCTCGTGCTGAACTTCCATCCATCATGC
CAAATCTTGAATCTCTTGCCCTAAAGTCATGCAAAGAGACGGCCTTTGCACCGAAGCTGT
GTAGCAAATTCCTCTGCCTCAGGCACTTGAGCATTGGCCTTATTGGATTTTTCCCAGCCT
ATGACTATTTATCCCTGGCTTCTTATATTTATGCTGCACCTTCTCTGGAGACTTTTGACT
TGAATGTAATGCAGCGGAACGTGCAGAGTGTTTCAATTTTTGCACATCCTGCAGATCTGA
GATCAATACGAGAAGAGAAGCATCACAACCTTAAGAGTGTGACGGTTACATCATTCATCT
CTGTAAAGAGCTTGGTTGAGCTGACATGCCATATCCTTGAGAGTACAGCTTCACTCGAGT
GCTTGACATTGGATGCTTCTCAGACTGGTTTTAGGTGTGATACTCCAGGCAGCAAAATCA
GCAAATGCCCCCCACTAGATAGGGACATTATCATGGAAGGTCACAGAGGGGTCTTGGCTA
TCAGAAGATACATCCAGCCTAGGGTACCTTCCACAGTGAAGCTGACTGTTTTGGAGCCCT
GCAGCTGCCATTCCACTGAACTTTAGATGTCATGTTTATCTTAGTTATTCGATGTTTAAT
CGTGCTGCTGCTGATGATGATTCTGTAGATTCTTAGATGGGTCATGGTTTCTAAAGTTTG
CTCTTAATGATTACTACTAGTTGATATCATAACCAATGCACATGATATCCACTAGTAACT
CTAGTTTCCACCTAGCAGCAGTGTTGTATGCACATTAAAAAGTTCTTACTAGCAGAAGTT
CTCGAACGTTTGATTTACCTACTTGTGGCCTTGTGGGTTATAAAAAGCTAAACATTAGAG
TTTGTAACAAATTTTAGTGTGTAGCCTTTAATTTCTTTTCACCTATATATGCATCGGTTT
CTT

CDS

1461 bp

>Os06t0139000-01 LRR-type F-box protein, Vegetative growth, Floral organ specification
TTGCTTTACGGGCTAAAAGAAAAGGGCTCACCCTGCCAACAAGACGGCGATTCTCAGGGT
GCTGCTGACATAGAGATACCAAGCCTTCCAGAGGACATCTGGCGTCTTATACATTCCTTG
ATGCCAATGCGGGATGCTGCCCGAGCTGCCTGTGTGTCTCATTCCTTTCTAAGTTCCTGG
AGATGCCACCCCAACCTCAATTTCAGTAGTGAAGCATTGGGGTTGAGCAAAAATGCATAT
GGAAACGAAGAATTGGCTGGACTTTTCTACAGCAAAGTCAACCACATTCTCAAAAGGCAC
TCAGGCATCGGCGTGAAAAAACTGACGATTAAGGTATATTCAGATTATAGTGGGAAGGGC
TCTTCATATCTCAACAATTGGCTTCAGATTGCTGTTAAACCAGGGATTGAAGAACTCATA
ATTGCACTGACCCAGTTCCAGGCAAAGTACAATTTCCCATGCTCTCTTCTGTCGAATGGG
AGTGGAGACTCAATCCAATATCTTCACCTTTCTAACTGTTCCTTCCACCCAACAGTCACA
CTTAGTGGCTTAAGAAGTCTGACGAGATTGTATCTTTGTCGTGTGCGTATTACCGAGAAC
GAGTTAGGCTGCCTTCTTTCCCATTCTCTTGCATTGGAGCAGTTGGAAATCAGGTACTGC
AATAGGATAGTTTGCCTGAAGGTACCTTGCCTACTGCAACGGCTCATCTCCCTGAAGGTG
TTTGGGTGTGACAAGTTGAAACTGATAGAAAATGAAGCTCCTAATGTCTCCATGTTTGCA
TTTCAAGGGGACAAAACGGAACTGAAACTTGGAGAAACTTTGCAAATAAAGAGCCTATGC
ATGGTCCGCTCTGGTTATGTTTATCATGCTCGTGCTGAACTTCCATCCATCATGCCAAAT
CTTGAATCTCTTGCCCTAAAGTCATGCAAAGAGACGGCCTTTGCACCGAAGCTGTGTAGC
AAATTCCTCTGCCTCAGGCACTTGAGCATTGGCCTTATTGGATTTTTCCCAGCCTATGAC
TATTTATCCCTGGCTTCTTATATTTATGCTGCACCTTCTCTGGAGACTTTTGACTTGAAT
GTAATGCAGCGGAACGTGCAGAGTGTTTCAATTTTTGCACATCCTGCAGATCTGAGATCA
ATACGAGAAGAGAAGCATCACAACCTTAAGAGTGTGACGGTTACATCATTCATCTCTGTA
AAGAGCTTGGTTGAGCTGACATGCCATATCCTTGAGAGTACAGCTTCACTCGAGTGCTTG
ACATTGGATGCTTCTCAGACTGGTTTTAGGTGTGATACTCCAGGCAGCAAAATCAGCAAA
TGCCCCCCACTAGATAGGGACATTATCATGGAAGGTCACAGAGGGGTCTTGGCTATCAGA
AGATACATCCAGCCTAGGGTACCTTCCACAGTGAAGCTGACTGTTTTGGAGCCCTGCAGC
TGCCATTCCACTGAACTTTAG

Protein

487 aa

>Os06t0139000-01 LRR-type F-box protein, Vegetative growth, Floral organ specification
LLYGLKEKGSPCQQDGDSQGAADIEIPSLPEDIWRLIHSLMPMRDAARAACVSHSFLSSW
RCHPNLNFSSEALGLSKNAYGNEELAGLFYSKVNHILKRHSGIGVKKLTIKVYSDYSGKG
SSYLNNWLQIAVKPGIEELIIALTQFQAKYNFPCSLLSNGSGDSIQYLHLSNCSFHPTVT
LSGLRSLTRLYLCRVRITENELGCLLSHSLALEQLEIRYCNRIVCLKVPCLLQRLISLKV
FGCDKLKLIENEAPNVSMFAFQGDKTELKLGETLQIKSLCMVRSGYVYHARAELPSIMPN
LESLALKSCKETAFAPKLCSKFLCLRHLSIGLIGFFPAYDYLSLASYIYAAPSLETFDLN
VMQRNVQSVSIFAHPADLRSIREEKHHNLKSVTVTSFISVKSLVELTCHILESTASLECL
TLDASQTGFRCDTPGSKISKCPPLDRDIIMEGHRGVLAIRRYIQPRVPSTVKLTVLEPCS
CHSTEL*

5'UTR

chr06:2061988..2062223 (- strand) : 236 bp

chr06:2060145..2060153 (- strand) : 9 bp

CDS

chr06:2060052..2060144 (- strand) : 93 bp

chr06:2058281..2059120 (- strand) : 840 bp

chr06:2058033..2058179 (- strand) : 147 bp

chr06:2057558..2057938 (- strand) : 381 bp

3'UTR

chr06:2057221..2057557 (- strand) : 337 bp

FASTA

>Os06t0139000-01 class=Sequence position=chr06:2057221..2062223 (- strand)
GGGCTCCTTC CTAAAATTAT AACTCTGATA TCTATATCTA TCTTGCCTAC AAATTATAAC TCTCGTTCCC CAATTTTGTG
TGTGACGTTG AGAAGTGCCG ACCGGCGACG ACGAAAGGCC GGCGGAGAGA GATCCCCTCA CCACCATGGG GATGCTGGAT
CTGATGCGCC TCATGTCCAT CCAGCGCCAG CGGGACCAGG AGCGCCGCCG CCGCCAAGCC CAAGCTCCCC CCCGTGGTAA
AGAAACTACT CCTCATAAGC TTCCTCTCCC ACCTCCCTCT GTCACTCTCT GGTCAAGCGG CGGCAGCAGC AGCAGCTTCT
TGCGTTTACG GTGGGGGAAG GGAACCAGAT GGACTTGCTT GCGCCTCTTT TTCCTGTTTC GTTGGGTGGG TGTTTATTTA
GTTTTCTTCA CACTAGTTTG TGTCGATTAT TCGAATCTGT ATATATGTAG TACTAGTATA TACACAAACC AAAAAGAAAA
AAAAACATGT TTTTATTGAG CGCAAGGTAG GAGATCAAAG GTGGTTTATC CGATCCGCCA TGGCTGGTGG CCGGCCACCA
CCGTCTTGTT CCTTTTCTCT TTAACTAGAT TGACGAGACG TAGGGAGAGA GACTACACTG TAACTATAAG GTACCCGCGT
GTTGCTGCGG GAATTCTTAG AACAATATTT GTGCGTATGG TCGCATGGAT AGCAAAAACA CTGAATTGCA TTGAAGTAAG
ACAACCTCTT TTTGTGTGAA TATGGAGTTA CGGTTTTGTT CAACATTCAA ATCAGTTGTG AAATATGAGG ATATATATCT
TGGTAGCTGA CAATTTAGAT ATTACCGTGG GCAACAGAAA AAGAAAAATG TTTAGTAATA CTGTGAGAAC TTGGCTAATG
ATGATAATTC AAAATCATAT ACATTGCTCC CCAAGTTGGA TAACAGGGTT AGCAAAAAAA AATTCATATT CAGATATGAA
AGAAGGTTCA GCAGATAAAC ATGGCTATTA AAATTCAGTT ACCGAACAAG GTTCACCAAC TAAAAATTTC CATCAAAATT
AAGAGTTTTA CGCACCTCAA TATTATACTT AGACTACGAA TCAACCAACT GATGGTCTTG TTTCCTGCAT TCTTCAATTG
CTTAAAAAGA AGAAAAGGAT CTGACAATGA AACCACAGCT ACATAGGGCA TCGACAGAAA GTGGTTAAAG TTGTAACTGC
ATATCTACAT AGCAGCATAC GATAGACACA TAATTGAAAG GTCCAGATTA GCATAGCTTC AAGCATCATA AAACATGAAG
CTAGTCATGG GTGGAAAGAT TCTGTGGAAG GACAGGGATA ATAAGCATAT TGATTTGAAC CTGCGGGAGT GGCATATCCT
GAGAGAGATA AGTTGTGTTG GGAAGGCTCA TCAGCTAGTG TCGTTGACCA GAGTGAGTTT GTCATCGTCG CCGGAGGATA
CAGCTCGTCT TTCTCTCTCC CATGAAGATC TGGCAGCATA GCTGAGAGCC TTTGAGAGGA AAGGAGAAGG CATATTGAGG
GTAATAAATG TCCATGGCGG CTGTCACTTC AACTCCTAGC TGTTTCAGGT TTTGATAGCG CGTTTCAGCC TTTCAGGCGA
GGGAGACTCA AAGGTGGACA TAGAAGCCGA ATGGCTCAGT TCTCTTGCGT CGTGTTGCGC TGAGAGTGGA GATGGAACGA
TAGGAGGTAG GATGTTCTGG GGTACGTAGG AACGTTTGGT TGGGTTTTCT GTGTGAGAGA CACTACATTC AATCTGATGG
AAATTAAGGG GTGATGTGGC AAAGCGAGAT GACCAAAAAA ATACTATTAA TTGCACTAAG TGGGGATGAA TTGTATCGGT
TTATAGGATA CTATACTATG CAAAATAAGA AAAATACTAT ATGACATGCT GAACTTCAGA CATTTCCCCT TAAATTGATA
ACACTTTGAT TTCTTTTACA AACTGTTAGT GTTGTTGTAC AAAAGGGGAC AAAAAAAAAA ATAACGGATT GCCATGTGTG
CAATGGTGTG CTTGCTTGAA TTTTCTGTTT ATTCCTGAAA TGGATGTAAA CCATGCATCT TGTGCTGCAG ATGGATTGAT
TGCTTTACGG GCTAAAAGAA AAGGGCTCAC CCTGCCAACA AGACGGCGAT TCTCAGGGTG CTGCTGACAT AGAGATACCA
AGCCTTCCAG AGGTACACCA TAAATAAAAT GTTGATGATG AAACATCTTA CTAGTAGTGT AGTACAAGTA AATTATGACG
ATTACTGCTT GAATCGCACA AATCGGTCGA CCAACGTTAT TAAAGTTTAT GAACGGAGCA CTTTGATGCT ATAACCTCCT
ACAGCTGCTG CATTGGAACT GTTTTTCCAG CTGTTGCACT TACTTTCAAT TACAAGTTGT GTCCACATAA TGCTTGCTTC
TAAGCTGGTG GTTCTTAGGC TGGGAGTTTC TCAAGTCAAC GTCAATGATT AGCCTTTGCC ACTAGTCTCC ATACTGTTTC
TAACTTCCTT AAATTTTAAC ATCTCAAAAA TGGTTCCTTG CTAACAAATG TGACATGTTA TCTCCGGTAG GCCATTGCAG
GCAGTACATG GTAATTTTGT GAGCCACATG TCCTTGTAGG ATGGCATTCT TGTTTGATTC CCCGCATCTC CCCATCCTGA
CTCCCCGCAT CTTCCCCATC CTGAGTTCCT GACCTAGTGT ATGAAAATCC AAGCAAGCAA CCAAACACAC CTTTAGTTCT
GTTACATATT TAACTGATCT TTCTGGTTGT TTATATATTC AGATATTGGT ACCCTATGCA AAGTGCATGT CCATTTCTGT
TCCTTTTATG CCATTGAATA ACATGCTATT AGACAATTAA ACATCATTCC ATCCATTTTA TCTGGCACAA TTGCAAAGAA
ACAAATAGTG CCGAGCACCT AATACATGAT TTGGGTAAGA CCATATTTGC CTAGCAGAAG TCAACTATAC AATTCATAGT
ACAATAGTAC ATAATCAGGC AGGTAGCACT GGACCGGTTA AAGTGTTAAC TCCATAAGTT ACCATTTTTT TTCTTCCATC
TAATTCAACC ATCTGTCTTC ACAATTCCAA TGGTTAACTT CTCTCCCATG CTTGTGCAAG CAGGACATCT GGCGTCTTAT
ACATTCCTTG ATGCCAATGC GGGATGCTGC CCGAGCTGCC TGTGTGTCTC ATTCCTTTCT AAGTTCCTGG AGATGCCACC
CCAACCTCAA TTTCAGTAGT GAAGCATTGG GGTTGAGCAA AAATGCATAT GGAAACGAAG AATTGGCTGG ACTTTTCTAC
AGCAAAGTCA ACCACATTCT CAAAAGGCAC TCAGGCATCG GCGTGAAAAA ACTGACGATT AAGGTATATT CAGATTATAG
TGGGAAGGGC TCTTCATATC TCAACAATTG GCTTCAGATT GCTGTTAAAC CAGGGATTGA AGAACTCATA ATTGCACTGA
CCCAGTTCCA GGCAAAGTAC AATTTCCCAT GCTCTCTTCT GTCGAATGGG AGTGGAGACT CAATCCAATA TCTTCACCTT
TCTAACTGTT CCTTCCACCC AACAGTCACA CTTAGTGGCT TAAGAAGTCT GACGAGATTG TATCTTTGTC GTGTGCGTAT
TACCGAGAAC GAGTTAGGCT GCCTTCTTTC CCATTCTCTT GCATTGGAGC AGTTGGAAAT CAGGTACTGC AATAGGATAG
TTTGCCTGAA GGTACCTTGC CTACTGCAAC GGCTCATCTC CCTGAAGGTG TTTGGGTGTG ACAAGTTGAA ACTGATAGAA
AATGAAGCTC CTAATGTCTC CATGTTTGCA TTTCAAGGGG ACAAAACGGA ACTGAAACTT GGAGAAACTT TGCAAATAAA
GAGCCTATGC ATGGTCCGCT CTGGTTATGT TTATCATGCT CGTGCTGAAC TTCCATCCAT CATGCCAAAT CTTGAATCTC
TTGCCCTAAA GTCATGCAAA GAGGTATGAG AAATTTTACC TGACACACTA ATGATAGGCA TATCTAATGA GACTAGATTC
TGTCTTATGG GTTGTAGCAT AATTAATTTG ACCTCTTTAT GCAGACGGCC TTTGCACCGA AGCTGTGTAG CAAATTCCTC
TGCCTCAGGC ACTTGAGCAT TGGCCTTATT GGATTTTTCC CAGCCTATGA CTATTTATCC CTGGCTTCTT ATATTTATGC
TGCACCTTCT CTGGAGACTT TTGACTTGAA TGTGAGTAGC TGTTCATATA TTATTACTGC TATGAATGAA ATTAGTAGCT
GTGTGGTGGA AATGTCACTT AAAATTTCTC CCTTTCACAT CCTAGGTAAT GCAGCGGAAC GTGCAGAGTG TTTCAATTTT
TGCACATCCT GCAGATCTGA GATCAATACG AGAAGAGAAG CATCACAACC TTAAGAGTGT GACGGTTACA TCATTCATCT
CTGTAAAGAG CTTGGTTGAG CTGACATGCC ATATCCTTGA GAGTACAGCT TCACTCGAGT GCTTGACATT GGATGCTTCT
CAGACTGGTT TTAGGTGTGA TACTCCAGGC AGCAAAATCA GCAAATGCCC CCCACTAGAT AGGGACATTA TCATGGAAGG
TCACAGAGGG GTCTTGGCTA TCAGAAGATA CATCCAGCCT AGGGTACCTT CCACAGTGAA GCTGACTGTT TTGGAGCCCT
GCAGCTGCCA TTCCACTGAA CTTTAGATGT CATGTTTATC TTAGTTATTC GATGTTTAAT CGTGCTGCTG CTGATGATGA
TTCTGTAGAT TCTTAGATGG GTCATGGTTT CTAAAGTTTG CTCTTAATGA TTACTACTAG TTGATATCAT AACCAATGCA
CATGATATCC ACTAGTAACT CTAGTTTCCA CCTAGCAGCA GTGTTGTATG CACATTAAAA AGTTCTTACT AGCAGAAGTT
CTCGAACGTT TGATTTACCT ACTTGTGGCC TTGTGGGTTA TAAAAAGCTA AACATTAGAG TTTGTAACAA ATTTTAGTGT
GTAGCCTTTA ATTTCTTTTC ACCTATATAT GCATCGGTTT CTT

Locus: Os06g0139000

Loading...

Locus: Os06g0139000

Loading...