Os06t0140800-01

Locus

Os06g0140800

Description

Protein kinase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK194

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 194

Oryzabase Gene Symbol Synonym(s)

OsPUB51, PUB51, OsRLCK194

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 51, U-box protein 51, Receptor-like Cytoplasmic Kinase 194

Transcript Evidence

AK065683 (DDBJ, Best hit)

Protein Evidence

A1YKF2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: response to stress (GO:0006950)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

U box domain (IPR003613)

UspA (IPR006016)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Rossmann-like alpha/beta/alpha sandwich fold (IPR014729)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J013037K06 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0140800-01)

RiceXPro (AK065683)

Others

Oryzabase (17842)

KEGG (Os06t0140800-01)

Transcript

2935 bp

>Os06t0140800-01 Protein kinase, core domain containing protein.
GTCGGCACCTCTAGCTTGACTCTATACCCGTCGTCTTCAGTCTCCTCCTCCCCTCTCATC
GCCACTCTCCTCGTCTCCTCCATGCCTCAGAGTGATTAGTTGAGAGGAGGAATCAAGAAT
CGAGGGAGAGGGTGAGGGAGATGGAGATCGAGGAGGCGGGCGGCGCCGGGGAGGATGAGC
TGGAAATGGAGGCTCCGAGCGTGAGCACGGTGGCGATTGCGGTGAACGGGAGCAGGAACA
GCAAGCACGCACTCAAGTGGGCTCTCGACAAGTTCGTCCCCGAAGGAAAGGTCCTCTTCC
AGATCTTGCATGTCCGCCCCACCATCAAGATGGTGCCAACTCCAATGGGCAATTTCATTC
CAATCACACAAGTGCGTGAAGACGTAGCAACTGCATACAAGAAAGAAGTGGAATGGCAAG
CAAACAATATGTTGCTTCCTTACAAGAAGATGTGTGCTCAGAGAAAGGTAGAAGCTGAAG
CTGTTTTACTCGAATCTGACGATGTGCCTACTGCTATAAGCGAAGAAATCAGCAAATTCA
GTGTCTGCAAGTTAGTTTTAGGTTCTTCTAGCAGCATATTCCGAAGGAAAAACAAAGGAA
GTAAGACTGCGACCAAAATCTGTGAGTGCATTCCAAGCTTCTGCACAGCATACGTTGTCT
CAAAAGGAAAACTATCATCTGTGCACTCAGCTACATCTGATGCCATCGGAACACCTGAAT
CCATTTCTTCTTCAACTGTTTCATCCCCAAGCTCTAGAAGCTTTTCATCCAGTGTACCCT
CAGAATGGGGAGACACATATGGGTCAGCAAATGTGTCATTCCACCAGCCATCTCTGTCAT
CTCAGCGTGACCAAGCAATTGCAAACATGAATAAGTTATCCAACAGGAGAGCTAGCCCTT
CAGGCAGTGGTGGGAGTGAGATCTCCAACCATGATGATACAGTCCTGACAAGTTCACACT
CGATCAATTCAGAAACACGGTTCAGTAGCAGCAGCAGTGGGAATTCTATCTATAAGAGCT
TCAATAGAGATCGTTCATTTGATAACTCTGATCAGGCATCCGTGTCAGATATGGCAACAA
ATCTGAAACATTCTCATGACCAGGAGTATCTAAAGCTTGAGATTGAGAGGCTGAGGGTTA
AACTACGGCATCTTCAGAAGCTTAATGAGTTAGCTCAGAAAGAATCATTGGACGCCAATC
AGAAATTACATAAGTTGGGCATCCAGGACATTGAGGATGAAATTAAGCTTAAAGAGACAG
AACTGACAGAAGAAAAGGTAAGGAGATTGATAAGGAAAAAAGAGAGAGAAGAACAGGAAG
TTGCCAGAAGAGAAGATCAATTAAGAAATGAAAATGCTGAAAGTGAAGCAACAAAACAGA
GTAATGGCAATCAGGAAGGTGATGAGAATAAGACAGGAGAGAGGATTTTCGTGCGCTGTT
TTGACGAGTATAACAGGTATACCTGGGAGGAGATAAAAGCATCGACTTTGTCACTGTCTG
AGGATCTTATGATTGGCAGGGGATCATATGGTACAGTGTACAAGGCTAAGTTTCATCATA
CAGTTGCAGCAGTAAAAGTTCTGAACTCCCCTGAAGGCTGTGGAACTCAGCAATTACAAC
AGGAGCTTGAGGTCCTAGGTAAAATCCGGCACCCTCACTTGCTCCTGATGCTAGGTGCAT
GCCCTGAGCATGGTTGCTTGGTCTACGAATTCATGGAAAATGGCAGCTTGGATGACATGC
TGCAACGGAGAAATAATACACCGCCATTGACCTGGTTTGACCGTTTCAGAATTGCTTGGG
AGGTTGCAACTGCTCTTATGTTCCTTCACAGTTCCAAACCAGAGCCTATCATACACCGGG
ATCTGAAGCCCGCAAACATATTGCTTGACAGGAACTTGGTTAGCAAGATAGGTGATGTAG
GTCTATCAACTTTGCTTCCAAGTATGGATCAGTACCTGTCCACAATGATCAAGAACACTG
CTCCAGTGGGCACTTTCTGTTACATAGACCCAGAGTATCAGAGAAGTGGCGTGGTCTCCA
TGAAGTCCGATGTTTATGCTCTAGGGATCGTGATCTTGCAATTGCTGACAGCGAAGTCAC
CAATGGGGATTGCCCATGTTGTGGAGACTGCACTAGAAGATGGACACTTCGTGGACATTC
TGGATGCAGCTGCTGGGCAGTGGCCTTTGAATGAGGCACAAGAATTGGCTTTCCTAGCCC
TAAAGTGTGCCGAAATGAGGCGCAGAGACCGGCCCGACTTGAGCGATCATGTTCTTCCAG
CATTGGAGCGGCTGAAGGATGTTGCAACCAAGGCCAGAGAAATGGCTTTTAATGGCCACC
AAACAGCACCTCCAAGTCACTTCATTTGCCCCATACTTCAGGAAGTGATGGCTGATCCAT
ATGTCGCATCGGATGGGTACACATATGACCGGAAGGCGATCGAGCTGTGGCTAAGTATGA
ATGACAAGTCCCCTATGACAAATCTGAGATTGCCTCACAAGAGCCTTATACCAAATCACT
CGCTTCGTTCTGCAATCATCGACTGGAGAACAAAGAGTTAGTAGCTGGTACACATTCTGG
CCTGCATTCTCCAGAATGTAGCAGTTGATGATTGATTTTCTTCTCAAGGTGTAAATTTTT
TGCAGATCTCATGTAGAAGTAGTCTTCATGTTGGTTCCAAAAATAAAAAATAAAATAAAA
TAAGTGGTGTTCATAAAGAGGTTCAAGTTGTGCAGCTTTATCAAATAGTAGTAGTAGAAA
TTGTTTCCTACTAGCTCATAGGCAAACACCTTCCACCTCACTGTCTTAGTGAATGGTGAA
CAATTATTTTTTTCTCCTTTGCCATTCATAATGATGTGTTGTAAGCTTGTAATTAGTGCT
CTCAACATTTGATCTGATTGTAGGAAATCTTAATGAAAATTCAGTATGAAGCTTT

CDS

2421 bp

>Os06t0140800-01 Protein kinase, core domain containing protein.
ATGGAGATCGAGGAGGCGGGCGGCGCCGGGGAGGATGAGCTGGAAATGGAGGCTCCGAGC
GTGAGCACGGTGGCGATTGCGGTGAACGGGAGCAGGAACAGCAAGCACGCACTCAAGTGG
GCTCTCGACAAGTTCGTCCCCGAAGGAAAGGTCCTCTTCCAGATCTTGCATGTCCGCCCC
ACCATCAAGATGGTGCCAACTCCAATGGGCAATTTCATTCCAATCACACAAGTGCGTGAA
GACGTAGCAACTGCATACAAGAAAGAAGTGGAATGGCAAGCAAACAATATGTTGCTTCCT
TACAAGAAGATGTGTGCTCAGAGAAAGGTAGAAGCTGAAGCTGTTTTACTCGAATCTGAC
GATGTGCCTACTGCTATAAGCGAAGAAATCAGCAAATTCAGTGTCTGCAAGTTAGTTTTA
GGTTCTTCTAGCAGCATATTCCGAAGGAAAAACAAAGGAAGTAAGACTGCGACCAAAATC
TGTGAGTGCATTCCAAGCTTCTGCACAGCATACGTTGTCTCAAAAGGAAAACTATCATCT
GTGCACTCAGCTACATCTGATGCCATCGGAACACCTGAATCCATTTCTTCTTCAACTGTT
TCATCCCCAAGCTCTAGAAGCTTTTCATCCAGTGTACCCTCAGAATGGGGAGACACATAT
GGGTCAGCAAATGTGTCATTCCACCAGCCATCTCTGTCATCTCAGCGTGACCAAGCAATT
GCAAACATGAATAAGTTATCCAACAGGAGAGCTAGCCCTTCAGGCAGTGGTGGGAGTGAG
ATCTCCAACCATGATGATACAGTCCTGACAAGTTCACACTCGATCAATTCAGAAACACGG
TTCAGTAGCAGCAGCAGTGGGAATTCTATCTATAAGAGCTTCAATAGAGATCGTTCATTT
GATAACTCTGATCAGGCATCCGTGTCAGATATGGCAACAAATCTGAAACATTCTCATGAC
CAGGAGTATCTAAAGCTTGAGATTGAGAGGCTGAGGGTTAAACTACGGCATCTTCAGAAG
CTTAATGAGTTAGCTCAGAAAGAATCATTGGACGCCAATCAGAAATTACATAAGTTGGGC
ATCCAGGACATTGAGGATGAAATTAAGCTTAAAGAGACAGAACTGACAGAAGAAAAGGTA
AGGAGATTGATAAGGAAAAAAGAGAGAGAAGAACAGGAAGTTGCCAGAAGAGAAGATCAA
TTAAGAAATGAAAATGCTGAAAGTGAAGCAACAAAACAGAGTAATGGCAATCAGGAAGGT
GATGAGAATAAGACAGGAGAGAGGATTTTCGTGCGCTGTTTTGACGAGTATAACAGGTAT
ACCTGGGAGGAGATAAAAGCATCGACTTTGTCACTGTCTGAGGATCTTATGATTGGCAGG
GGATCATATGGTACAGTGTACAAGGCTAAGTTTCATCATACAGTTGCAGCAGTAAAAGTT
CTGAACTCCCCTGAAGGCTGTGGAACTCAGCAATTACAACAGGAGCTTGAGGTCCTAGGT
AAAATCCGGCACCCTCACTTGCTCCTGATGCTAGGTGCATGCCCTGAGCATGGTTGCTTG
GTCTACGAATTCATGGAAAATGGCAGCTTGGATGACATGCTGCAACGGAGAAATAATACA
CCGCCATTGACCTGGTTTGACCGTTTCAGAATTGCTTGGGAGGTTGCAACTGCTCTTATG
TTCCTTCACAGTTCCAAACCAGAGCCTATCATACACCGGGATCTGAAGCCCGCAAACATA
TTGCTTGACAGGAACTTGGTTAGCAAGATAGGTGATGTAGGTCTATCAACTTTGCTTCCA
AGTATGGATCAGTACCTGTCCACAATGATCAAGAACACTGCTCCAGTGGGCACTTTCTGT
TACATAGACCCAGAGTATCAGAGAAGTGGCGTGGTCTCCATGAAGTCCGATGTTTATGCT
CTAGGGATCGTGATCTTGCAATTGCTGACAGCGAAGTCACCAATGGGGATTGCCCATGTT
GTGGAGACTGCACTAGAAGATGGACACTTCGTGGACATTCTGGATGCAGCTGCTGGGCAG
TGGCCTTTGAATGAGGCACAAGAATTGGCTTTCCTAGCCCTAAAGTGTGCCGAAATGAGG
CGCAGAGACCGGCCCGACTTGAGCGATCATGTTCTTCCAGCATTGGAGCGGCTGAAGGAT
GTTGCAACCAAGGCCAGAGAAATGGCTTTTAATGGCCACCAAACAGCACCTCCAAGTCAC
TTCATTTGCCCCATACTTCAGGAAGTGATGGCTGATCCATATGTCGCATCGGATGGGTAC
ACATATGACCGGAAGGCGATCGAGCTGTGGCTAAGTATGAATGACAAGTCCCCTATGACA
AATCTGAGATTGCCTCACAAGAGCCTTATACCAAATCACTCGCTTCGTTCTGCAATCATC
GACTGGAGAACAAAGAGTTAG

Protein

807 aa

>Os06t0140800-01 Protein kinase, core domain containing protein.
MEIEEAGGAGEDELEMEAPSVSTVAIAVNGSRNSKHALKWALDKFVPEGKVLFQILHVRP
TIKMVPTPMGNFIPITQVREDVATAYKKEVEWQANNMLLPYKKMCAQRKVEAEAVLLESD
DVPTAISEEISKFSVCKLVLGSSSSIFRRKNKGSKTATKICECIPSFCTAYVVSKGKLSS
VHSATSDAIGTPESISSSTVSSPSSRSFSSSVPSEWGDTYGSANVSFHQPSLSSQRDQAI
ANMNKLSNRRASPSGSGGSEISNHDDTVLTSSHSINSETRFSSSSSGNSIYKSFNRDRSF
DNSDQASVSDMATNLKHSHDQEYLKLEIERLRVKLRHLQKLNELAQKESLDANQKLHKLG
IQDIEDEIKLKETELTEEKVRRLIRKKEREEQEVARREDQLRNENAESEATKQSNGNQEG
DENKTGERIFVRCFDEYNRYTWEEIKASTLSLSEDLMIGRGSYGTVYKAKFHHTVAAVKV
LNSPEGCGTQQLQQELEVLGKIRHPHLLLMLGACPEHGCLVYEFMENGSLDDMLQRRNNT
PPLTWFDRFRIAWEVATALMFLHSSKPEPIIHRDLKPANILLDRNLVSKIGDVGLSTLLP
SMDQYLSTMIKNTAPVGTFCYIDPEYQRSGVVSMKSDVYALGIVILQLLTAKSPMGIAHV
VETALEDGHFVDILDAAAGQWPLNEAQELAFLALKCAEMRRRDRPDLSDHVLPALERLKD
VATKAREMAFNGHQTAPPSHFICPILQEVMADPYVASDGYTYDRKAIELWLSMNDKSPMT
NLRLPHKSLIPNHSLRSAIIDWRTKS*

5'UTR

chr06:2146525..2146616 (- strand) : 92 bp

chr06:2146090..2146137 (- strand) : 48 bp

CDS

chr06:2145885..2146089 (- strand) : 205 bp

chr06:2144884..2145005 (- strand) : 122 bp

chr06:2144676..2144794 (- strand) : 119 bp

chr06:2143358..2143554 (- strand) : 197 bp

chr06:2142565..2142884 (- strand) : 320 bp

chr06:2142350..2142451 (- strand) : 102 bp

chr06:2141838..2142257 (- strand) : 420 bp

chr06:2140724..2141479 (- strand) : 756 bp

chr06:2140429..2140608 (- strand) : 180 bp

3'UTR

chr06:2140055..2140428 (- strand) : 374 bp

FASTA

>Os06t0140800-01 class=Sequence position=chr06:2140055..2146616 (- strand)
GTCGGCACCT CTAGCTTGAC TCTATACCCG TCGTCTTCAG TCTCCTCCTC CCCTCTCATC GCCACTCTCC TCGTCTCCTC
CATGCCTCAG AGGTACGGAC AAGGCAATCT CTCTGCCCCT CGCGAGTTCT TGTTTCATCC GAAACATCAA CCCCGGCTGA
AAGCTGTCGC CTTTTGTTTT TTTTTTTTTG GAGGGGGGAT CTTGTCGTAC CGGTTTTTTC TTCCTTTTTC GCCATATGGA
TTGTGGGTTT TTTTACCTGG GATTTTCCTT TGCGTTCCTG AGATTTCACA TGACTGTTTG TGCATTGTGT TGCGAGAAAT
TTGGGGGAAG AATCACGGAC AGGGATTTTC CTTTGCGTTT CTGAGATTAT TTCCCATGAC TGTTTATGCA TTGTGTTGCG
AGGAATTTTG GGGGAAGAAT CACGGACAGG GCGATTTGTT TTTTGTTCTA ATCATTTGGC TCTTTTTTTC TTGGGACAGT
GATTAGTTGA GAGGAGGAAT CAAGAATCGA GGGAGAGGGT GAGGGAGATG GAGATCGAGG AGGCGGGCGG CGCCGGGGAG
GATGAGCTGG AAATGGAGGC TCCGAGCGTG AGCACGGTGG CGATTGCGGT GAACGGGAGC AGGAACAGCA AGCACGCACT
CAAGTGGGCT CTCGACAAGT TCGTCCCCGA AGGAAAGGTC CTCTTCCAGA TCTTGCATGT CCGCCCCACC ATCAAGATGG
TGCCAACTCC AAGTGAGACA TTTCTTCCTC TTGATTCTCT GAATTTTCAG TTCTTGCAGT TTACAGGGAT GGGGGGAAAA
ATATGCAGTC TTTGGAGGCA ATGAACCTTG TTGTGAAGTG ACTAGTCTCT TGGATGAGTT TTTTTTTTAA TTTCCTTTTT
CTTAAAGAGG GGAATATCAA ATACTATGGT TTGTTGTTTA GGAAGTTTTG ATCGGAGGAG GTGTCATTTG ATACATCAGA
GAGGGGAATT AAAATGAGAG GTTTTACTTG GTCATTGCCA CCAAATGTGG AATTCGTTTC ACAAAGCTGC ATAGACTAGC
CAAATACAAT GCACATTGTC GTTGTTGCCT ACTACTACCC AACCCAATTG ATGAGTGTGA AACTTGAGCT CTTGATTATT
ATTTTTTTAA AAAAAATCTG ATTTGCGAGA AGGGACTAAT GGATGATAAA CAAATATTTT GCTCACTGCA ACTAGTGGAA
AGATATATAC GTATTATGCT CTGTACCCAA GGTATCTATG TGGTATCTTT TGATGTCATA TAGGAATATA CTCCTAGCTT
CAATTAAACG GGGAGGCAGG AAATTGAAGT GCTTTTTATC AGTTCCAAAC TTTCAATAAT TGATCTAGAT CTGTTCAATA
GTACCATCTA ATCATCTATG AACAAAGTTG TGATTGTAAT GTCACAACTA CCGAGTACCA ACTAAAATAG TTTGGGGTGC
TGCAATATGA GGTTGTTTGA TTGTACTAAT TGTGGATAAT TAGGGAGAGT ACGAATCCCA TAACTTTTGT GTACTAATTG
TGGATAATTT CTATTTAGGA GTGCGTTTTT CTGCTAGTTA CCATTTCGAC CATTTAATAC GGAGCTTTTC TTTTCTCCCT
ACTCCTTTAA GTGGGCAATT TCATTCCAAT CACACAAGTG CGTGAAGACG TAGCAACTGC ATACAAGAAA GAAGTGGAAT
GGCAAGCAAA CAATATGTTG CTTCCTTACA AGAAGATGTG TGCTCAGAGA AAGGTTATCC TACAATTTGT CTAAGTGCGC
TGATTGCGGT GGTTGGTGTA ACTGATGACT AAAATAGCAT CTTTACTCTA TCTGATGTAC AGGTAGAAGC TGAAGCTGTT
TTACTCGAAT CTGACGATGT GCCTACTGCT ATAAGCGAAG AAATCAGCAA ATTCAGTGTC TGCAAGTTAG TTTTAGGTTC
TTCTAGCAGC ATATTCCGAA GGTTAATTCT CCCCGTTATT CGTTACCTAA TTTATTTGAG CATTTATTTA TATTACCAAA
TATAAATCTA TATACATGAC CACTGAATGT TTGAAAAACA TTCATATACT CATGCTACTC AATGTTTCTA TTACTAACTG
CAAATTGTAG GGGTACTAAA ATTTGTCTTC TGATCCACAA ATCAGAATTA ACAATTATAT ATATTTATAT TCAGTAATCT
ATCAGGAACC TTTCGAATTC TTACTTACTA CTTCCAGAAA ATACCTATCA TTGGAAGTTT CAACACTACA GTGTTGCTGC
ACTGTGTAGT TGTGGACAAA TGCCATTCTA GTGGCATGCA TTAGTTGGGC AAGTTAGTGC AAATGGCGAT AAACTTTTGG
GCAGATAGCT GGTCTATTAT AATTGATCAT AAGGAAACCT AAGATTTCAG TACAATGATC ATCCTTGATC ATTTAATGCC
CCACGTTCCA GCCTACCACT GAGGTTTGCA ATGCAACTAC TTGATTGCAA GTTTTGTTAG TAATAGAAGT GGACAAACAA
TCCAAACTGA ACAATTATAC AGCAAAAAAG GCATTGCGTA CTGCAGGGGC AGATACATCC GTCTCAAAAT AAGTTTACTT
TTATACATGA ATATGGACTT ATCCTATATC CAAATTCATG TATAAAAGTG AACTTACTTT GGGATAAATT TTGAAtggta
taagttgtta tattttggga ctaattttga atgctataag ttgttatatt ttgggatgta gtgagtaGTC GTTTCACATT
CATTTgagaa aggcccgggg ggtcttccgg ctagcaccac gaggtgtggg ctagccgacc cgggtttgag cctcaccact
ctcttaataa attttgatat gagagccctt cctctcatat ccaacgtttC ACATTCATTT GTTCAGGGCA ATTCTTCAGT
AGATCATTTT TTAATACAAC TTACAATGGT CATCAACTCA CCATTATGTA CGTTCTAAAT CGATAGACCT TTTAAAACTG
CTCTATTGAG AATTCACAGC ATGTGCATTC TAGAGTTAGA AAATGTGTTT TATATGTGTA CAATGTTGGT CACATCGCTA
ACAATTTTAA CTACTATATC AGGAAAAACA AAGGAAGTAA GACTGCGACC AAAATCTGTG AGTGCATTCC AAGCTTCTGC
ACAGCATACG TTGTCTCAAA AGGAAAACTA TCATCTGTGC ACTCAGCTAC ATCTGATGCC ATCGGAACAC CTGAATCCAT
TTCTTCTTCA ACTGTTTCAT CCCCAAGCTC TAGAAGCTTT TCATCCAGTG TACCCTCAGG TAATACACAA GTCTGTATGT
TTTTGCCTTG TGTATTTGTT GGTACACCTT TCAACTGAAT ACAATGAATT CGACTTCTTG AGAGCTAAGT CAATGAAGAG
TCAATGTTTT TTCACTttgt atttctccca atcttaataa aattggtcga ccgaaccttt cagccgaacc agcaaaaaaG
TCAATGAAGA GTACTGTCAA TCATTTTCAC GTGAATGTTT TGAGGTTCAT CAATTCATGC ACTTGCCATG TTATTTCTCT
TTAAATTCAA TGGCCGAATA TATATATTTT TTATAATCAA TGACCGAATG TTGGCGTAAC ATGTAAGATA ACATCTGGTT
TATAAACATA TTTACCACCC TAGACTATTT AATGCATTTG ATTAGATGTA GCAACCTTTT AGGAACTGTG TATTTGATCA
TTTATGCCTT TTTTTCTCTT TGTCAGTGTA CTAAATATGT TGAATACTGC AGAATGGGGA GACACATATG GGTCAGCAAA
TGTGTCATTC CACCAGCCAT CTCTGTCATC TCAGCGTGAC CAAGCAATTG CAAACATGAA TAAGTTATCC AACAGGAGAG
CTAGCCCTTC AGGCAGTGGT GGGAGTGAGA TCTCCAACCA TGATGATACA GTCCTGACAA GTTCACACTC GATCAATTCA
GAAACACGGT TCAGTAGCAG CAGCAGTGGG AATTCTATCT ATAAGAGCTT CAATAGAGAT CGTTCATTTG ATAACTCTGA
TCAGGCATCC GTGTCAGATA TGGCAACAAA TCTGAAACAT TCTCATGACC AGGTATTAAA TCCATTCAAG AAAACAAGAT
GAAACATATT CTTTTTCAAA GTAATATGCA CATGACTGAA AATTTCATGT TTCTCATACC CTTATATGTA ACTTCTGTTA
AGCAGGAGTA TCTAAAGCTT GAGATTGAGA GGCTGAGGGT TAAACTACGG CATCTTCAGA AGCTTAATGA GTTAGCTCAG
AAAGAATCAT TGGACGCCAA TCAGAAAGTA AGTTTTACAT TTTAATGGTA GGAGCTATAC AATAAATTTG GGCATAGCCT
ACAATGTCTA ACTTTTTCCA GTTGAATGTT TGTTATTAGT TACATAAGTT GGGCATCCAG GACATTGAGG ATGAAATTAA
GCTTAAAGAG ACAGAACTGA CAGAAGAAAA GGTAAGGAGA TTGATAAGGA AAAAAGAGAG AGAAGAACAG GAAGTTGCCA
GAAGAGAAGA TCAATTAAGA AATGAAAATG CTGAAAGTGA AGCAACAAAA CAGAGTAATG GCAATCAGGA AGGTGATGAG
AATAAGACAG GAGAGAGGAT TTTCGTGCGC TGTTTTGACG AGTATAACAG GTATACCTGG GAGGAGATAA AAGCATCGAC
TTTGTCACTG TCTGAGGATC TTATGATTGG CAGGGGATCA TATGGTACAG TGTACAAGGC TAAGTTTCAT CATACAGTTG
CAGCAGTAAA AGTTCTGAAC TCCCCTGAAG GCTGTGGAAC TCAGCAATTA CAACAGGAGG TACTGTCATT TTCTCCCCAA
CACTCACCTT TTTAGCTGTT CAGTACACTG TACTCTAAGG CAAGATCTAA CCACCATTAA ACAACCCCGG ACGAAGTGCA
ATGGTTTCAT CAATCAAATT TGACAAAATA AAAAGCATTC TCCAGTGGTA CACCTTTATT TTGTGATGTG CAAAAGCAAA
CAGCAGAATC TTCTCTTTTG CTAAGACAAA ATTCTTGAAC CCTCTGAACT GTCTTAATAG GAGTTCACAA ACTATTTATG
CAGATATAGT GCAAAATCAT CCTCTGATCA TCCTTATTCA AAGTACAATA ACATCTTCAG TCTAAACGAT GCAACTCATC
TTTTTTTCTT TTGTCAGCTT GAGGTCCTAG GTAAAATCCG GCACCCTCAC TTGCTCCTGA TGCTAGGTGC ATGCCCTGAG
CATGGTTGCT TGGTCTACGA ATTCATGGAA AATGGCAGCT TGGATGACAT GCTGCAACGG AGAAATAATA CACCGCCATT
GACCTGGTTT GACCGTTTCA GAATTGCTTG GGAGGTTGCA ACTGCTCTTA TGTTCCTTCA CAGTTCCAAA CCAGAGCCTA
TCATACACCG GGATCTGAAG CCCGCAAACA TATTGCTTGA CAGGAACTTG GTTAGCAAGA TAGGTGATGT AGGTCTATCA
ACTTTGCTTC CAAGTATGGA TCAGTACCTG TCCACAATGA TCAAGAACAC TGCTCCAGTG GGCACTTTCT GTTACATAGA
CCCAGAGTAT CAGAGAAGTG GCGTGGTCTC CATGAAGTCC GATGTTTATG CTCTAGGGAT CGTGATCTTG CAATTGCTGA
CAGCGAAGTC ACCAATGGGG ATTGCCCATG TTGTGGAGAC TGCACTAGAA GATGGACACT TCGTGGACAT TCTGGATGCA
GCTGCTGGGC AGTGGCCTTT GAATGAGGCA CAAGAATTGG CTTTCCTAGC CCTAAAGTGT GCCGAAATGA GGCGCAGAGA
CCGGCCCGAC TTGAGCGATC ATGTTCTTCC AGCATTGGAG CGGCTGAAGG ATGTTGCAAC CAAGGCCAGA GAAATGGCTT
TTAATGGCCA CCAAACAGCA CCTCCAAGTC ACTTCATTTG CCCCATACTT CAGGTTTGTA TCAACACTTG TCATGATTGT
GACAGTCTCA CAGCAAAAAT TACTCCTTTT CCCTTTGAAA AAGAGAATCA CAGTAACTTT GCTGATGATG TTCTTAATAA
TGTTTCAGGA AGTGATGGCT GATCCATATG TCGCATCGGA TGGGTACACA TATGACCGGA AGGCGATCGA GCTGTGGCTA
AGTATGAATG ACAAGTCCCC TATGACAAAT CTGAGATTGC CTCACAAGAG CCTTATACCA AATCACTCGC TTCGTTCTGC
AATCATCGAC TGGAGAACAA AGAGTTAGTA GCTGGTACAC ATTCTGGCCT GCATTCTCCA GAATGTAGCA GTTGATGATT
GATTTTCTTC TCAAGGTGTA AATTTTTTGC AGATCTCATG TAGAAGTAGT CTTCATGTTG GTTCCAAAAA TAAAAAATAA
AATAAAATAA GTGGTGTTCA TAAAGAGGTT CAAGTTGTGC AGCTTTATCA AATAGTAGTA GTAGAAATTG TTTCCTACTA
GCTCATAGGC AAACACCTTC CACCTCACTG TCTTAGTGAA TGGTGAACAA TTATTTTTTT CTCCTTTGCC ATTCATAATG
ATGTGTTGTA AGCTTGTAAT TAGTGCTCTC AACATTTGAT CTGATTGTAG GAAATCTTAA TGAAAATTCA GTATGAAGCT
TT

Locus: Os06g0140800

Loading...

Locus: Os06g0140800

Loading...