Os06t0140800-02

Locus

Os06g0140800

Description

Similar to Serine threonine kinase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK194

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 194

Oryzabase Gene Symbol Synonym(s)

OsPUB51, PUB51, OsRLCK194

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 51, U-box protein 51, Receptor-like Cytoplasmic Kinase 194

Transcript Evidence

AK105657 (DDBJ, Best hit)

Protein Evidence

A1YKF2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

U box domain (IPR003613)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-200-G08 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0140800-02)

RiceXPro (AK105657)

Others

Oryzabase (17842)

KEGG (Os06t0140800-02)

Transcript

1405 bp

>Os06t0140800-02 Similar to Serine threonine kinase.
AAGGAGATTGATAAGGAAAAAAGAGAGAGAAGAACAGGAAGTTGCCAGAAGAGAAGATCA
ATTAAGAAATGAAAATGCTGAAAGTGAAGCAACAAAACAGAGTAATGGCAATCAGGAAGG
TGATGAGAATAAGACAGGAGAGAGGATTTTCGTGCGCTGTTTTGACGAGTATAACAGGTA
TACCTGGGAGGAGATAAAAGCATCGACTTTGTCACTGTCTGAGGATCTTATGATTGGCAG
GGGATCATATGGTACAGTGTACAAGGCTAAGTTTCATCATACAGTTGCAGCAGTAAAAGT
TCTGAACTCCCCTGAAGGCTGTGGAACTCAGCAATTACAACAGGAGCTTGAGGTCCTAGG
TAAAATCCGGCACCCTCACTTGCTCCTGATGCTAGGTGCATGCCCTGAGCATGGTTGCTT
GGTCTACGAATTCATGGAAAATGGCAGCTTGGATGACATGCTGCAACGGAGAAATAATAC
ACCGCCATTGACCTGGTTTGACCGTTTCAGAATTGCTTGGGAGGTTGCAACTGCTCTTAT
GTTCCTTCACAGTTCCAAACCAGAGCCTATCATACACCGGGATCTGAAGCCCGCAAACAT
ATTGCTTGACAGGAACTTGGTTAGCAAGATAGGTGATGTAGGTCTATCAACTTTGCTTCC
AAGTATGGATCAGTACCTGTCCACAATGATCAAGAACACTGCTCCAGTGGGCACTTTCTG
TTACATAGACCCAGAGTATCAGAGAAGTGGCGTGGTCTCCATGAAGTCCGATGTTTATGC
TCTAGGGATCGTGATCTTGCAATTGCTGACAGCGAAGTCACCAATGGGGATTGCCCATGT
TGTGGAGACTGCACTAGAAGATGGACACTTCGTGGACATTCTGGATGCAGCTGCTGGGCA
GTGGCCTTTGAATGAGGCACAAGAATTGGCTTTCCTAGCCCTAAAGTGTGCCGAAATGAG
GCGCAGAGACCGGCCCGACTTGAGCGATCATGTTCTTCCAGCATTGGAGCGGCTGAAGGA
TGTTGCAACCAAGGCCAGAGAAATGGCTTTTAATGGCCACCAAACAGCACCTCCAAGTCA
CTTCATTTGCCCCATACTTCAGGAAGTGATGGCTGATCCATATGTCGCATCGGATGGGTA
CACATATGACCGGAAGGCGATCGAGCTGTGGCTAAGTATGAATGACAAGTCCCCTATGAC
AAATCTGAGATTGCCTCACAAGAGCCTTATACCAAATCACTCGCTTCGTTCTGCAATCAT
CGACTGGAGAACAAAGAGTTAGTAGCTGGTACACATTCTGGCCTGCATTCTCCAGAATGT
AGCAGTTGATGATTGATTTTCTTCTCAAGGTGTAAATTTTTTGCAGATCTCATGTAGAAG
TAGTCTTCATGTTGGTTCCAAAAAT

CDS

1281 bp

>Os06t0140800-02 Similar to Serine threonine kinase.
AGGAGATTGATAAGGAAAAAAGAGAGAGAAGAACAGGAAGTTGCCAGAAGAGAAGATCAA
TTAAGAAATGAAAATGCTGAAAGTGAAGCAACAAAACAGAGTAATGGCAATCAGGAAGGT
GATGAGAATAAGACAGGAGAGAGGATTTTCGTGCGCTGTTTTGACGAGTATAACAGGTAT
ACCTGGGAGGAGATAAAAGCATCGACTTTGTCACTGTCTGAGGATCTTATGATTGGCAGG
GGATCATATGGTACAGTGTACAAGGCTAAGTTTCATCATACAGTTGCAGCAGTAAAAGTT
CTGAACTCCCCTGAAGGCTGTGGAACTCAGCAATTACAACAGGAGCTTGAGGTCCTAGGT
AAAATCCGGCACCCTCACTTGCTCCTGATGCTAGGTGCATGCCCTGAGCATGGTTGCTTG
GTCTACGAATTCATGGAAAATGGCAGCTTGGATGACATGCTGCAACGGAGAAATAATACA
CCGCCATTGACCTGGTTTGACCGTTTCAGAATTGCTTGGGAGGTTGCAACTGCTCTTATG
TTCCTTCACAGTTCCAAACCAGAGCCTATCATACACCGGGATCTGAAGCCCGCAAACATA
TTGCTTGACAGGAACTTGGTTAGCAAGATAGGTGATGTAGGTCTATCAACTTTGCTTCCA
AGTATGGATCAGTACCTGTCCACAATGATCAAGAACACTGCTCCAGTGGGCACTTTCTGT
TACATAGACCCAGAGTATCAGAGAAGTGGCGTGGTCTCCATGAAGTCCGATGTTTATGCT
CTAGGGATCGTGATCTTGCAATTGCTGACAGCGAAGTCACCAATGGGGATTGCCCATGTT
GTGGAGACTGCACTAGAAGATGGACACTTCGTGGACATTCTGGATGCAGCTGCTGGGCAG
TGGCCTTTGAATGAGGCACAAGAATTGGCTTTCCTAGCCCTAAAGTGTGCCGAAATGAGG
CGCAGAGACCGGCCCGACTTGAGCGATCATGTTCTTCCAGCATTGGAGCGGCTGAAGGAT
GTTGCAACCAAGGCCAGAGAAATGGCTTTTAATGGCCACCAAACAGCACCTCCAAGTCAC
TTCATTTGCCCCATACTTCAGGAAGTGATGGCTGATCCATATGTCGCATCGGATGGGTAC
ACATATGACCGGAAGGCGATCGAGCTGTGGCTAAGTATGAATGACAAGTCCCCTATGACA
AATCTGAGATTGCCTCACAAGAGCCTTATACCAAATCACTCGCTTCGTTCTGCAATCATC
GACTGGAGAACAAAGAGTTAG

Protein

427 aa

>Os06t0140800-02 Similar to Serine threonine kinase.
RRLIRKKEREEQEVARREDQLRNENAESEATKQSNGNQEGDENKTGERIFVRCFDEYNRY
TWEEIKASTLSLSEDLMIGRGSYGTVYKAKFHHTVAAVKVLNSPEGCGTQQLQQELEVLG
KIRHPHLLLMLGACPEHGCLVYEFMENGSLDDMLQRRNNTPPLTWFDRFRIAWEVATALM
FLHSSKPEPIIHRDLKPANILLDRNLVSKIGDVGLSTLLPSMDQYLSTMIKNTAPVGTFC
YIDPEYQRSGVVSMKSDVYALGIVILQLLTAKSPMGIAHVVETALEDGHFVDILDAAAGQ
WPLNEAQELAFLALKCAEMRRRDRPDLSDHVLPALERLKDVATKAREMAFNGHQTAPPSH
FICPILQEVMADPYVASDGYTYDRKAIELWLSMNDKSPMTNLRLPHKSLIPNHSLRSAII
DWRTKS*

5'UTR

chr06:2142183..2142183 (- strand) : 1 bp

CDS

chr06:2141838..2142182 (- strand) : 345 bp

chr06:2140724..2141479 (- strand) : 756 bp

chr06:2140429..2140608 (- strand) : 180 bp

3'UTR

chr06:2140306..2140428 (- strand) : 123 bp

FASTA

>Os06t0140800-02 class=Sequence position=chr06:2140306..2142183 (- strand)
AAGGAGATTG ATAAGGAAAA AAGAGAGAGA AGAACAGGAA GTTGCCAGAA GAGAAGATCA ATTAAGAAAT GAAAATGCTG
AAAGTGAAGC AACAAAACAG AGTAATGGCA ATCAGGAAGG TGATGAGAAT AAGACAGGAG AGAGGATTTT CGTGCGCTGT
TTTGACGAGT ATAACAGGTA TACCTGGGAG GAGATAAAAG CATCGACTTT GTCACTGTCT GAGGATCTTA TGATTGGCAG
GGGATCATAT GGTACAGTGT ACAAGGCTAA GTTTCATCAT ACAGTTGCAG CAGTAAAAGT TCTGAACTCC CCTGAAGGCT
GTGGAACTCA GCAATTACAA CAGGAGGTAC TGTCATTTTC TCCCCAACAC TCACCTTTTT AGCTGTTCAG TACACTGTAC
TCTAAGGCAA GATCTAACCA CCATTAAACA ACCCCGGACG AAGTGCAATG GTTTCATCAA TCAAATTTGA CAAAATAAAA
AGCATTCTCC AGTGGTACAC CTTTATTTTG TGATGTGCAA AAGCAAACAG CAGAATCTTC TCTTTTGCTA AGACAAAATT
CTTGAACCCT CTGAACTGTC TTAATAGGAG TTCACAAACT ATTTATGCAG ATATAGTGCA AAATCATCCT CTGATCATCC
TTATTCAAAG TACAATAACA TCTTCAGTCT AAACGATGCA ACTCATCTTT TTTTCTTTTG TCAGCTTGAG GTCCTAGGTA
AAATCCGGCA CCCTCACTTG CTCCTGATGC TAGGTGCATG CCCTGAGCAT GGTTGCTTGG TCTACGAATT CATGGAAAAT
GGCAGCTTGG ATGACATGCT GCAACGGAGA AATAATACAC CGCCATTGAC CTGGTTTGAC CGTTTCAGAA TTGCTTGGGA
GGTTGCAACT GCTCTTATGT TCCTTCACAG TTCCAAACCA GAGCCTATCA TACACCGGGA TCTGAAGCCC GCAAACATAT
TGCTTGACAG GAACTTGGTT AGCAAGATAG GTGATGTAGG TCTATCAACT TTGCTTCCAA GTATGGATCA GTACCTGTCC
ACAATGATCA AGAACACTGC TCCAGTGGGC ACTTTCTGTT ACATAGACCC AGAGTATCAG AGAAGTGGCG TGGTCTCCAT
GAAGTCCGAT GTTTATGCTC TAGGGATCGT GATCTTGCAA TTGCTGACAG CGAAGTCACC AATGGGGATT GCCCATGTTG
TGGAGACTGC ACTAGAAGAT GGACACTTCG TGGACATTCT GGATGCAGCT GCTGGGCAGT GGCCTTTGAA TGAGGCACAA
GAATTGGCTT TCCTAGCCCT AAAGTGTGCC GAAATGAGGC GCAGAGACCG GCCCGACTTG AGCGATCATG TTCTTCCAGC
ATTGGAGCGG CTGAAGGATG TTGCAACCAA GGCCAGAGAA ATGGCTTTTA ATGGCCACCA AACAGCACCT CCAAGTCACT
TCATTTGCCC CATACTTCAG GTTTGTATCA ACACTTGTCA TGATTGTGAC AGTCTCACAG CAAAAATTAC TCCTTTTCCC
TTTGAAAAAG AGAATCACAG TAACTTTGCT GATGATGTTC TTAATAATGT TTCAGGAAGT GATGGCTGAT CCATATGTCG
CATCGGATGG GTACACATAT GACCGGAAGG CGATCGAGCT GTGGCTAAGT ATGAATGACA AGTCCCCTAT GACAAATCTG
AGATTGCCTC ACAAGAGCCT TATACCAAAT CACTCGCTTC GTTCTGCAAT CATCGACTGG AGAACAAAGA GTTAGTAGCT
GGTACACATT CTGGCCTGCA TTCTCCAGAA TGTAGCAGTT GATGATTGAT TTTCTTCTCA AGGTGTAAAT TTTTTGCAGA
TCTCATGTAG AAGTAGTCTT CATGTTGGTT CCAAAAAT

Locus: Os06g0140800

Loading...

Locus: Os06g0140800

Loading...