Os06t0142600-01

Locus

Os06g0142600

Description

Homolog of the Arabidopsis EARLY FLOWERING 3 protein, Photoperiodic flowering, Short-day/long-day promotion

RAP-DB Gene Symbol Synonym(s)

HD3B, Hd17, EF7, Ef7, OsELF3-1, OsELF3, ELF3_chr.6

RAP-DB Gene Name Synonym(s)

HEADING DATE 3B, HEADING DATE 17, EARLINESS 7, EARLY FLOWERING 3-1

CGSNL Gene Symbol

HD3B

CGSNL Gene Name

HEADING DATE 3B

Oryzabase Gene Symbol Synonym(s)

Hd17, EF7, Ef7, OsELF3-1, OsELF3, ELF3, ELF3_chr.6, OsELF3.1, ELF3.1

Oryzabase Gene Name Synonym(s)

HEADING DATE 17, EARLINESS 7, EARLY FLOWERING 3-1, EARLY FLOWERING3.1, EARLY FLOWERING 3.1, ELF3 homolog 1, Heading date from Qingluzhan 11, EARLY FLOWERING3

Transcript Evidence

AB683966

Protein Evidence

Q9SNQ6

Literature

PMID: 22399582

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

October 2, 2014

Expression Databases

TENOR (Os06t0142600-01)

Others

Oryzabase (8705)

Transcript

2283 bp

>Os06t0142600-01 Homolog of the Arabidopsis EARLY FLOWERING 3 protein, Photoperiodic flowering, Short-day/long-day promotion
ATGGCGACGAGGGGAGGAGGCGGAGgaggaggagggaaggaggcgaaggggaaggtgatg
ggcccgctgttcccgcggctccacgtcaacgacgcggccaagggcggaggcccgcgggcg
ccgccccggaacaagatggcgctctacgagcagttcaccgtgccctcgcatcgcttcagc
ggcggaggaggcggcggcggagtaggaggcagccccgcgcactcgacgtcggcggcgagc
cAGAGCCAGAGCCAGAGCCAGGTTTATGGACGTGACAGTTCTCTGTTCCAGCCGTTCAAT
GTGCCTTCCAATCGACCTGGCCATTCTACTGAAAAGATCAATTCAGATAAGATCAACAAG
AAGATTAGTGGTTCAAGAAAAGAACTGGGGATGTTATCCTCTCAGACTAAGGGCATGGAT
ATTTATGCTTCAAGATCAACTGCTGAGGCACCACAAAGAAGAGCAGAAAATACAATAAAG
AGTTCTTCGGGAAAGAGATTGGCCGATGATGATGAATTTATGGTTCCTTCTGTCTTCAAT
TCCAGATTTCCTCAATATAGTACTCAAGAGAATGCAGGGGTTCAAGACCAATCAACACCC
CTTGTTGCTGCAAATCCACACAAAAGCCCTTCAACAGTGTCCAAATCATCCACAAAGTGT
TATAACACTGTTAGCAAGAAATTGGAGAGAATCCATGTTTCTGATGTGAAATCAAGGACC
CCTTTGAAAGACAAGGAGATGGAAGCAGCACAGACATCCAAAAACGTGGAAGTTGAAAAA
AGTTCATCCTTTCATGCTTCCAAAGATATGTTTGAAAGCAGGCATGCTAAAGTATATCCT
AAGATGGATAAGACGGGCATTATAAATGATTCTGATGAGCCACATGGTGGAAATAGTGGG
CATCAAGCGACAAGCAGAAATGGAGGTTCCATGAAATTTCAGAACCCTCCAATGAGAAGA
AATGAAATTTCCTCTAATCCATCTTCTGAAAATACTGATAGGCATTATAATTTACCGCAA
GGAGGCATAGAGGAAACAGGTACAAAGAGAAAAAGGTTGCTAGAACAACACGATGCAGAG
AAAAGTGATGATGTGTCAAGGTTGCTAGAACAACACGATGCAGAGAACATTGATGATGTG
TCTGATTCCTCGGTGGAGTGTATAACTGGTTGGGAGATTTCTCCAGATAAAATTGTTGGA
GCCATTGGTACAAAGCATTTCTGGAAAGCAAGACGTGCTATTATGAATCAACAGAGGGTG
TTTGCTGTCCAGGTTTTTGAGCTGCATAAGTTGGTAAAAGTGCAGAAGTTGATTGCAGCA
TCGCCACATGTACTTATTGAAAGTGATCCTTGCCTTGGCAATGCCTTGTTGGGTAGCAAG
AACAAGCTGGTGGAAGAAAACCTGAAAGCACAACCTCTTTTAGTCGCAACCATCGATGAC
GTGGAGCCAAGTCTACAGCAACCGGAGGTATCAAAAGAAAACACTGAAGACAGCCCACCC
TCCCCTCATGATACTGGGCTTGGCAGTGGTCAACGTGATCAAGCTGCAACAAATGGCGTC
TCTAAAAGCAATCGTCGAGCTACACCTGTTGCTTCTGATAACAAACAAAATAACTGGGGC
GTTCAACTTCAACCACCTCAAAATCAATGGCTTGTCCCTGTCATGTCTCCTTTGGAAGGC
CTTGTCTATAAGCCTTATTCTGGTCCGTGCCCTCCAGCTGGTAGCATATTGGCCCCGTTT
TATGCCAACTGTACTCCTTTGAGTCTTCCATCAACAGCTGGAGATTTCATGAACTCGGCA
TACGGTGTTCCTATGCCTCATCAGCCACAACATATGGGTGCTCCTGGCCCTCCTTCCATG
CCTATGAACTACTTCCCGCCTTTCAGCATACCAGTGATGAACCCAACTGCACCGGCACCT
GTAGTCGAACAAGGGAGACATCCTTCGATGCCACAGCCTTATGGGAACTTTGAGCAGCAG
TCGTGGATCTCATGTAACATGTCACATCCAAGTGGCATTTGGAGATTTCATGCCTCAAGA
GATAGCGAGGCACAGGCCAGCAGCGCTAGCAGTCCTTTTGACAGGTTCCAATGCAGTGGA
AGTGGTCCTGTATCCGCCTTCCCCACAGTATCAGCTCAGAACAACCAGCCTCAGCCCTCA
TATAGCAGCCGGGACAACCAGACCAATGTTATCAAGGTTGTTCCACATAATTCACGAACT
GCTTCAGAGTCAGCAGCACGGATTTTCCGGTCAATACAAATGGAACGGCAACGAGATGAT
TGA

CDS

2283 bp

>Os06t0142600-01 Homolog of the Arabidopsis EARLY FLOWERING 3 protein, Photoperiodic flowering, Short-day/long-day promotion
ATGGCGACGAGGGGAGGAGGCGGAGgaggaggagggaaggaggcgaaggggaaggtgatg
ggcccgctgttcccgcggctccacgtcaacgacgcggccaagggcggaggcccgcgggcg
ccgccccggaacaagatggcgctctacgagcagttcaccgtgccctcgcatcgcttcagc
ggcggaggaggcggcggcggagtaggaggcagccccgcgcactcgacgtcggcggcgagc
cAGAGCCAGAGCCAGAGCCAGGTTTATGGACGTGACAGTTCTCTGTTCCAGCCGTTCAAT
GTGCCTTCCAATCGACCTGGCCATTCTACTGAAAAGATCAATTCAGATAAGATCAACAAG
AAGATTAGTGGTTCAAGAAAAGAACTGGGGATGTTATCCTCTCAGACTAAGGGCATGGAT
ATTTATGCTTCAAGATCAACTGCTGAGGCACCACAAAGAAGAGCAGAAAATACAATAAAG
AGTTCTTCGGGAAAGAGATTGGCCGATGATGATGAATTTATGGTTCCTTCTGTCTTCAAT
TCCAGATTTCCTCAATATAGTACTCAAGAGAATGCAGGGGTTCAAGACCAATCAACACCC
CTTGTTGCTGCAAATCCACACAAAAGCCCTTCAACAGTGTCCAAATCATCCACAAAGTGT
TATAACACTGTTAGCAAGAAATTGGAGAGAATCCATGTTTCTGATGTGAAATCAAGGACC
CCTTTGAAAGACAAGGAGATGGAAGCAGCACAGACATCCAAAAACGTGGAAGTTGAAAAA
AGTTCATCCTTTCATGCTTCCAAAGATATGTTTGAAAGCAGGCATGCTAAAGTATATCCT
AAGATGGATAAGACGGGCATTATAAATGATTCTGATGAGCCACATGGTGGAAATAGTGGG
CATCAAGCGACAAGCAGAAATGGAGGTTCCATGAAATTTCAGAACCCTCCAATGAGAAGA
AATGAAATTTCCTCTAATCCATCTTCTGAAAATACTGATAGGCATTATAATTTACCGCAA
GGAGGCATAGAGGAAACAGGTACAAAGAGAAAAAGGTTGCTAGAACAACACGATGCAGAG
AAAAGTGATGATGTGTCAAGGTTGCTAGAACAACACGATGCAGAGAACATTGATGATGTG
TCTGATTCCTCGGTGGAGTGTATAACTGGTTGGGAGATTTCTCCAGATAAAATTGTTGGA
GCCATTGGTACAAAGCATTTCTGGAAAGCAAGACGTGCTATTATGAATCAACAGAGGGTG
TTTGCTGTCCAGGTTTTTGAGCTGCATAAGTTGGTAAAAGTGCAGAAGTTGATTGCAGCA
TCGCCACATGTACTTATTGAAAGTGATCCTTGCCTTGGCAATGCCTTGTTGGGTAGCAAG
AACAAGCTGGTGGAAGAAAACCTGAAAGCACAACCTCTTTTAGTCGCAACCATCGATGAC
GTGGAGCCAAGTCTACAGCAACCGGAGGTATCAAAAGAAAACACTGAAGACAGCCCACCC
TCCCCTCATGATACTGGGCTTGGCAGTGGTCAACGTGATCAAGCTGCAACAAATGGCGTC
TCTAAAAGCAATCGTCGAGCTACACCTGTTGCTTCTGATAACAAACAAAATAACTGGGGC
GTTCAACTTCAACCACCTCAAAATCAATGGCTTGTCCCTGTCATGTCTCCTTTGGAAGGC
CTTGTCTATAAGCCTTATTCTGGTCCGTGCCCTCCAGCTGGTAGCATATTGGCCCCGTTT
TATGCCAACTGTACTCCTTTGAGTCTTCCATCAACAGCTGGAGATTTCATGAACTCGGCA
TACGGTGTTCCTATGCCTCATCAGCCACAACATATGGGTGCTCCTGGCCCTCCTTCCATG
CCTATGAACTACTTCCCGCCTTTCAGCATACCAGTGATGAACCCAACTGCACCGGCACCT
GTAGTCGAACAAGGGAGACATCCTTCGATGCCACAGCCTTATGGGAACTTTGAGCAGCAG
TCGTGGATCTCATGTAACATGTCACATCCAAGTGGCATTTGGAGATTTCATGCCTCAAGA
GATAGCGAGGCACAGGCCAGCAGCGCTAGCAGTCCTTTTGACAGGTTCCAATGCAGTGGA
AGTGGTCCTGTATCCGCCTTCCCCACAGTATCAGCTCAGAACAACCAGCCTCAGCCCTCA
TATAGCAGCCGGGACAACCAGACCAATGTTATCAAGGTTGTTCCACATAATTCACGAACT
GCTTCAGAGTCAGCAGCACGGATTTTCCGGTCAATACAAATGGAACGGCAACGAGATGAT
TGA

Protein

761 aa

>Os06t0142600-01 Homolog of the Arabidopsis EARLY FLOWERING 3 protein, Photoperiodic flowering, Short-day/long-day promotion
MATRGGGGGGGGKEAKGKVMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFS
GGGGGGGVGGSPAHSTSAASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINK
KISGSRKELGMLSSQTKGMDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFN
SRFPQYSTQENAGVQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRT
PLKDKEMEAAQTSKNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSG
HQATSRNGGSMKFQNPPMRRNEISSNPSSENTDRHYNLPQGGIEETGTKRKRLLEQHDAE
KSDDVSRLLEQHDAENIDDVSDSSVECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRV
FAVQVFELHKLVKVQKLIAASPHVLIESDPCLGNALLGSKNKLVEENLKAQPLLVATIDD
VEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATPVASDNKQNNWG
VQLQPPQNQWLVPVMSPLEGLVYKPYSGPCPPAGSILAPFYANCTPLSLPSTAGDFMNSA
YGVPMPHQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQGRHPSMPQPYGNFEQQ
SWISCNMSHPSGIWRFHASRDSEAQASSASSPFDRFQCSGSGPVSAFPTVSAQNNQPQPS
YSSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQRDD*

CDS

chr06:2238798..2239058 (- strand) : 261 bp

chr06:2236414..2237399 (- strand) : 986 bp

chr06:2235678..2235729 (- strand) : 52 bp

chr06:2234581..2235564 (- strand) : 984 bp

FASTA

>Os06t0142600-01 class=Sequence position=chr06:2234581..2239058 (- strand)
ATGGCGACGA GGGGAGGAGG CGGAGgagga ggagggaagg aggcgaaggg gaaggtgatg ggcccgctgt tcccgcggct
ccacgtcaac gacgcggcca agggcggagg cccgcgggcg ccgccccgga acaagatggc gctctacgag cagttcaccg
tgccctcgca tcgcttcagc ggcggaggag gcggcggcgg agtaggaggc agccccgcgc actcgacgtc ggcggcgagc
cAGAGCCAGA GCCAGAGCCA GGTGACTCGA CGTCCTGCCC GTATGATCGA TTCGATTGGG GGTAGTGTGT GCGACTGCTA
AATTGGTACT AGTAGGCGAC AATTCTGTGC AAATGGAGCT AAACGCCTTG CAAATCGAAT CGAATTAGAA GCCTAAATTG
GTAGGCAATA ATTCTGTGCA ATGGAGCTAA ACTTCCTTGC AAATCGAATA GAACTAAAAG CTGGGAAGAT AATTTCGAGG
CACAAATGGT GCCCTCGACG TCGACGAGCT AGGTCAGAGG GGGCGTTTCA CGCCTTACCC TTTGTAGTTA TCTCGGTTGG
GATAGATGAA TTGATGGGCG AATTTAGTGC AACGGAGCTA AACACATGGA AAAATTGGAT AAGATTAAGG CCGAGAAGCC
CAGTTTGAGG CACAAATGCC ATGTTCCTTT TGTGCTGATT AATCTATCAT GCCGTCGACA TGTGATTCAA TTACTTGCAA
ATATAGTCAT ACAATTGTGG TAGGAGTAAC ATGCTTGCAC GTTGTCATAG TGTCATTATT GATCTTTCTC CGTGCTGATA
ACTCACTTGT GTTGAAGGCG AAAGAGCAGA ACAAAACCAT TATATGCAGT TTACATCAGC TCTTCCGGTA AAGTTTTGGA
GACGGGGCAT AAGTTCCTTG CAAACAATAT CGGATATTAT AGCTTATTGC AAATTGTATA TGGCCAGATA TGCTATGATT
GTGTTTGCTG AGGTCTGGTG TTTGTAATAT ACAAACAAAA AGgtccacat gtgaaactgc atgtagcgca ggtggcaaag
agtagccgta gtgctgctca acgtactgtg ttctattctc cctgacgtgc tcaccttcct taaatcattg acactaggtt
cctccttagt gtcttgcatt ttTGCCTGCC GAAAAAAAAA GGTCCACGTG AAAGGGAATG ATAAAAATGG TGGTTGATAT
GCTTTGATTG TCAGGCACAC GTTCAACCTG TATGTGATAA ATATCAACGG TTTTCTAATA CTGTTTTCAG CAAGGATTTA
GGAGTGGAAA ATATTCTTTA GAACAAATCT GCAATAGCCT CCCACAACAC ATCCAACTAC CTTTTGATAA TGGGATAGTT
ATAGACATGA AGTGCGAATG GCAAAAGTCC AAGTCATAGA TTTCCAAATG AAGAAATGTG AACAAAATAA GAAAGAAAGA
AGTCCATTTG CAGTATTATG TCTCTTTTGC CCTTCTTTGG GTCGAAAATA AAATAAAAAA TCGAGATCTT ACCATGAGAT
ACTTAATCTC CCACCACTTT TTCTAATTCA ACATGGAAGT TCTTGGATAG TTTAAATACG CTTCCTACCA ATTAGCGTGG
AATCCTCGCA ATTTTTCACT AAATCTAGTA GTACTGAAAT GGATTTTATT TTCTTCCAGG TTTATGGACG TGACAGTTCT
CTGTTCCAGC CGTTCAATGT GCCTTCCAAT CGACCTGGCC ATTCTACTGA AAAGATCAAT TCAGATAAGA TCAACAAGAA
GATTAGTGGT TCAAGAAAAG AACTGGGGAT GTTATCCTCT CAGACTAAGG GCATGGATAT TTATGCTTCA AGATCAACTG
CTGAGGCACC ACAAAGAAGA GCAGAAAATA CAATAAAGAG TTCTTCGGGA AAGAGATTGG CCGATGATGA TGAATTTATG
GTTCCTTCTG TCTTCAATTC CAGATTTCCT CAATATAGTA CTCAAGAGAA TGCAGGGGTT CAAGACCAAT CAACACCCCT
TGTTGCTGCA AATCCACACA AAAGCCCTTC AACAGTGTCC AAATCATCCA CAAAGTGTTA TAACACTGTT AGCAAGAAAT
TGGAGAGAAT CCATGTTTCT GATGTGAAAT CAAGGACCCC TTTGAAAGAC AAGGAGATGG AAGCAGCACA GACATCCAAA
AACGTGGAAG TTGAAAAAAG TTCATCCTTT CATGCTTCCA AAGATATGTT TGAAAGCAGG CATGCTAAAG TATATCCTAA
GATGGATAAG ACGGGCATTA TAAATGATTC TGATGAGCCA CATGGTGGAA ATAGTGGGCA TCAAGCGACA AGCAGAAATG
GAGGTTCCAT GAAATTTCAG AACCCTCCAA TGAGAAGAAA TGAAATTTCC TCTAATCCAT CTTCTGAAAA TACTGATAGG
CATTATAATT TACCGCAAGG AGGCATAGAG GAAACAGGTA CAAAGAGAAA AAGGTTGCTA GAACAACACG ATGCAGAGAA
AAGTGATGAT GTGTCAAGGT TGCTAGAACA ACACGATGCA GAGAACATTG ATGATGTGTC TGATTCCTCG GTGGAGTGTA
TAACTGGTTG GGAGATTTCT CCAGATAAAA TTGTTGGAGC CATTGGTACA AAGCATTTCT GGAAAGCAAG ACGTGCTATT
ATGAAGTAAG TAAAACTATC CTTTTGAGCT TAGTTTGGCC CACTCAAACT AGACTTGTTT GCAGCTCTAA TTACGTATAG
GTAGCTTTGA TGAATAAAAT TTGTTTTGTT TCCCTTGCTT TACTGTTATT TGCTCTTAAT TTGCGGTTGA TCTTAATCAT
CTTAGACAGA AAAACATGAT GACTATCTCG TTTGTTTTTG GTTTATTTCA TATTTGAATG CCAATAGATG TCAGCTCCAG
ATGATATTTC AAATACCTCA TGCATGGAAA CTGTGCATAC TTATGCCAAA TTTTGGGCTT ACAAGTCAGC ATGTCTACAA
ATTTCTTTGG CAGAATTAAT ATATATCTAG TTCAACATTT GCTGATTTGT AATTGGATTA GTTGTCTGCA GAATGCCGGC
ATGTTTTATT TTCCTTTCAA CTAGGTCAAT CAGTTTTGTT GTTGTCTGTT GTTCTTGTCC ACCTACACCT GTACTACTGA
AATGTTCTCT TTTGGAGATG TCAATGAAAA TTTTAATCTA TAGTGGTTTC AATTTTATTT TCATTTTAGT CAAGAAGAAT
GGCATAATCT CATTTAAAAA GATTGTAAAA GTGTCCCTGT TAAAGTGATA TTGTAGGTAT TGCTTTACCA AGCTACTGTA
TGATTCCCTT TATTGTTTTA CACTCTAATC TTCTTTAAAC TCTATGCAGT CAACAGAGGG TGTTTGCTGT CCAGGTTTTT
GAGCTGCATA AGTTGGTAAA AGTGAGTCTA GCAAATTTCT CTTCCTTCTA GCCACTCTTA AGCAGGTTAA TTCGTGGATA
GGATTTTGTC CATAATCTGT TTATAACCCA CACTTGTATT TGACTTACAA TCAGGTGCAG AAGTTGATTG CAGCATCGCC
ACATGTACTT ATTGAAAGTG ATCCTTGCCT TGGCAATGCC TTGTTGGGTA GCAAGAACAA GCTGGTGGAA GAAAACCTGA
AAGCACAACC TCTTTTAGTC GCAACCATCG ATGACGTGGA GCCAAGTCTA CAGCAACCGG AGGTATCAAA AGAAAACACT
GAAGACAGCC CACCCTCCCC TCATGATACT GGGCTTGGCA GTGGTCAACG TGATCAAGCT GCAACAAATG GCGTCTCTAA
AAGCAATCGT CGAGCTACAC CTGTTGCTTC TGATAACAAA CAAAATAACT GGGGCGTTCA ACTTCAACCA CCTCAAAATC
AATGGCTTGT CCCTGTCATG TCTCCTTTGG AAGGCCTTGT CTATAAGCCT TATTCTGGTC CGTGCCCTCC AGCTGGTAGC
ATATTGGCCC CGTTTTATGC CAACTGTACT CCTTTGAGTC TTCCATCAAC AGCTGGAGAT TTCATGAACT CGGCATACGG
TGTTCCTATG CCTCATCAGC CACAACATAT GGGTGCTCCT GGCCCTCCTT CCATGCCTAT GAACTACTTC CCGCCTTTCA
GCATACCAGT GATGAACCCA ACTGCACCGG CACCTGTAGT CGAACAAGGG AGACATCCTT CGATGCCACA GCCTTATGGG
AACTTTGAGC AGCAGTCGTG GATCTCATGT AACATGTCAC ATCCAAGTGG CATTTGGAGA TTTCATGCCT CAAGAGATAG
CGAGGCACAG GCCAGCAGCG CTAGCAGTCC TTTTGACAGG TTCCAATGCA GTGGAAGTGG TCCTGTATCC GCCTTCCCCA
CAGTATCAGC TCAGAACAAC CAGCCTCAGC CCTCATATAG CAGCCGGGAC AACCAGACCA ATGTTATCAA GGTTGTTCCA
CATAATTCAC GAACTGCTTC AGAGTCAGCA GCACGGATTT TCCGGTCAAT ACAAATGGAA CGGCAACGAG ATGATTGA