Os06t0143700-01

Locus

Os06g0143700

Description

Similar to Sulfate transporter 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SULTR3;4

CGSNL Gene Name

SULPHATE TRANSPORTER 3;4

Oryzabase Gene Symbol Synonym(s)

OsSultr3;4, OsSul3;4, OsaSULTR3;4, SPDT

Oryzabase Gene Name Synonym(s)

sulphate transporter 3;4, SULTR-like phosphorus distribution transporter

Transcript Evidence

AK067270 (DDBJ, Best hit)

Protein Evidence

NP_001148179.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Biological Process: sulfate transport (GO:0008272)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: transporter activity (GO:0005215)

Molecular Function: secondary active sulfate transmembrane transporter activity (GO:0008271)

Functional domain (InterPro)

Sulphate anion transporter (IPR001902)

Sulphate transporter/antisigma-factor antagonist STAS (IPR002645)

Sulphate transporter (IPR011547)

Sulphate anion transporter, conserved site (IPR018045)

Full-length cDNA

J013098O05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0143700-01)

RiceXPro (AK067270)

Others

Oryzabase (9323)

KEGG (Os06t0143700-01)

Transcript

2494 bp

>Os06t0143700-01 Similar to Sulfate transporter 2.
AAGCAGCCAAGGCGCCTCCCTTCCTAATCCTACCTCGATCGCCTCCTCCCTCTCGACTCG
ATCGCCATGGTTGTCAACAACAAGGTGGACAGCCTCTCCTacgacgtcgaggcgccaccg
gcgcaggcgccgacgaccccggcggtggtctccgcgccgccgacgccgcggggcgaggcg
ccggcgatgacgacgacggcggcggcggagctgcacaaggtgtcggtgccggagaggagg
tcgacggcgaaggcgctgaggcagcggctggcggaggtgTTCTTCCCCGACGACCCGCTC
CACCAGTTCAAGAACCAGTCGTCCGCGCGGCGGCTGGTGCTCGCGCTGCAGTACTTCTTC
CCCATCTTCCATTGGGGCTCcgactacagcctccgcctcctccgctccgacgtcgtctcc
ggcctcaccattgccagcctcGCCATCCCGCAGGGAATCAGCTACGCCAAGCTCGCCAAC
CTGCCTCCAATCATTGGACTATATTCGAGCTTCGTGCCGCCGCTGATCTACTCGTTGTTG
GGTAGCTCGCGGGATCTGGCTGTAGGGCCGGTGTCGATAGCGTCGCTGGTGATGGGGTCG
ATgctccggcaggcggtgtcgccggaccaggagcccatcctctacctccagctcgccttc
acctccaccttcttcgccggcgtcttccaagcctccctcggcttcctccGGCTGGGGTTC
ATCGTGGATTTCTTGTCGAAGGCGACGCTGACGGGATTCATGGGCGGCGCGGCGATCATC
GTGTCGCTGCAGCAGCTCAAGGGATTGCTCGGGATCATCCATTTCACGTCGCAGATGGGG
TTCGTCCAGGTGATGCACTCCGTCTTCAAGCACCACGACGAGTGGGCGTGGCAGACCATC
CTCATGGGCGTCGCCTTCCTCGCCGTCCTCCTCACCACACGCCACATCAGCGCCAGGAAC
CCAAAGCTTTTCTGGGTGTCAGCAGCTGCTCCACTGACATCAGTGATCATCTCTACCATC
ATCTCGTTCGTCAGCAAAGCTCATGGCATCAGTGTTATTGGCGATCTCCCCAAGGGATTG
AACCCTCCTTCAGCGAATATGCTGACCTTCAGTGGCTCCTACGTAGGACTGGCCTTAAAC
ACAGGAATTATGACTGGCATACTATCTCTCACTGAAGGGATAGCAGTAGGCAGGACATTT
GCATCCATCAACAACTACCAGGTTGATGGAAACAAGGAGATGATGGCCATTGGTGTCATG
AACATGGCTGGCTCATGTGCCTCCTGCTATGTCACCACAGGATCGTTCTCGAGGTCGGCG
GTGAACTACAGCGCGGGGTGCAAGACGGCGGTGTCGAACATCGTGATGGCGTCGGCGGTG
CTGGTGACGCTGCTGTTCCTGATGCCGCTGTTCCACTACACCCCCAACGTGATCCTCTCG
GCGATCATCATCACCGCCGTGATCGGCCTCATCGACGTCCGGGGCGCCGCCAGGCTGTGG
AAGGTCGACAAGCTCGACTTCCTCGCCTGCATGGccgccttcctcggcgtcctcctcgtc
tccgtccagatgggcctcgccatcgccgtcggcatctccctcttcaagatcctcctcCAG
GTCACCCGCCCAAACATGGTGGTCAAGGGCGTCGTCCCCGGCACGGCGAGCTACCGGAGC
ATGGCGCAGTACAGGGAGGCCATGCGTGTGCCGTCCTTCCTCGTCGTCGGCGTCGAGTCC
GCCATCTACTTCGCCAACTCCATGTACCTCGGCGAGAGGATCATGAGGTTTCTCCGGGAG
GAAGACGAGCGGGCCGCCAAGTGCAACCAGTGCCCTGTCAGATGCATCATCCTCGACATG
AGTGCTGTTGCAGCGATCGACACGAGTGGCCTCGATGCACTTGCAGAGCTGAAGAAGGTG
CTGGAAAAAAGAAACATCGAGCTTGTGCTGGCCAACCCGGTTGGATCGGTGACCGAGAGG
CTGTACAACTCGGTGGTCGGCAAGACGTTCGGCTCAGACCGCGTGTTCTTCAGCGTCGCC
GAGGCCGTCGCGGCGGCGCCGCACAAAACACAGCCCTGACAAGAGCAGAGATGTGCTTTG
CTACCAGTAGATCCAGCAGAAGCAGAAGTACTCTCTGACCAGCAGAAGCACAGTAGAACA
AGGTGCTTCTCGGAGGAGGCTAATTAAAATTAAGAATCTTAAGATAGAAGCGTAGAACAA
GAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGGTGGTAAA
AAACAAGTCTATGGGCTGTTAATTTGTTCGCGTGTTGTGTTTAATTAGGGGGGATTATGG
TAGTGCAGATGGGAAATAACTCCGGGTGCTGATCTCTTCTGATCGAGTTGGAAGAGTTTT
TGAAGCATGTAACCAGAATGCGTGGCGTGTATGGTGTAGCTTGTGATTTGGTAGTTGTTG
CAAAGTAATCCTTAATGGAATCGGGTTTTGATCT

CDS

2013 bp

>Os06t0143700-01 Similar to Sulfate transporter 2.
ATGGTTGTCAACAACAAGGTGGACAGCCTCTCCTacgacgtcgaggcgccaccggcgcag
gcgccgacgaccccggcggtggtctccgcgccgccgacgccgcggggcgaggcgccggcg
atgacgacgacggcggcggcggagctgcacaaggtgtcggtgccggagaggaggtcgacg
gcgaaggcgctgaggcagcggctggcggaggtgTTCTTCCCCGACGACCCGCTCCACCAG
TTCAAGAACCAGTCGTCCGCGCGGCGGCTGGTGCTCGCGCTGCAGTACTTCTTCCCCATC
TTCCATTGGGGCTCcgactacagcctccgcctcctccgctccgacgtcgtctccggcctc
accattgccagcctcGCCATCCCGCAGGGAATCAGCTACGCCAAGCTCGCCAACCTGCCT
CCAATCATTGGACTATATTCGAGCTTCGTGCCGCCGCTGATCTACTCGTTGTTGGGTAGC
TCGCGGGATCTGGCTGTAGGGCCGGTGTCGATAGCGTCGCTGGTGATGGGGTCGATgctc
cggcaggcggtgtcgccggaccaggagcccatcctctacctccagctcgccttcacctcc
accttcttcgccggcgtcttccaagcctccctcggcttcctccGGCTGGGGTTCATCGTG
GATTTCTTGTCGAAGGCGACGCTGACGGGATTCATGGGCGGCGCGGCGATCATCGTGTCG
CTGCAGCAGCTCAAGGGATTGCTCGGGATCATCCATTTCACGTCGCAGATGGGGTTCGTC
CAGGTGATGCACTCCGTCTTCAAGCACCACGACGAGTGGGCGTGGCAGACCATCCTCATG
GGCGTCGCCTTCCTCGCCGTCCTCCTCACCACACGCCACATCAGCGCCAGGAACCCAAAG
CTTTTCTGGGTGTCAGCAGCTGCTCCACTGACATCAGTGATCATCTCTACCATCATCTCG
TTCGTCAGCAAAGCTCATGGCATCAGTGTTATTGGCGATCTCCCCAAGGGATTGAACCCT
CCTTCAGCGAATATGCTGACCTTCAGTGGCTCCTACGTAGGACTGGCCTTAAACACAGGA
ATTATGACTGGCATACTATCTCTCACTGAAGGGATAGCAGTAGGCAGGACATTTGCATCC
ATCAACAACTACCAGGTTGATGGAAACAAGGAGATGATGGCCATTGGTGTCATGAACATG
GCTGGCTCATGTGCCTCCTGCTATGTCACCACAGGATCGTTCTCGAGGTCGGCGGTGAAC
TACAGCGCGGGGTGCAAGACGGCGGTGTCGAACATCGTGATGGCGTCGGCGGTGCTGGTG
ACGCTGCTGTTCCTGATGCCGCTGTTCCACTACACCCCCAACGTGATCCTCTCGGCGATC
ATCATCACCGCCGTGATCGGCCTCATCGACGTCCGGGGCGCCGCCAGGCTGTGGAAGGTC
GACAAGCTCGACTTCCTCGCCTGCATGGccgccttcctcggcgtcctcctcgtctccgtc
cagatgggcctcgccatcgccgtcggcatctccctcttcaagatcctcctcCAGGTCACC
CGCCCAAACATGGTGGTCAAGGGCGTCGTCCCCGGCACGGCGAGCTACCGGAGCATGGCG
CAGTACAGGGAGGCCATGCGTGTGCCGTCCTTCCTCGTCGTCGGCGTCGAGTCCGCCATC
TACTTCGCCAACTCCATGTACCTCGGCGAGAGGATCATGAGGTTTCTCCGGGAGGAAGAC
GAGCGGGCCGCCAAGTGCAACCAGTGCCCTGTCAGATGCATCATCCTCGACATGAGTGCT
GTTGCAGCGATCGACACGAGTGGCCTCGATGCACTTGCAGAGCTGAAGAAGGTGCTGGAA
AAAAGAAACATCGAGCTTGTGCTGGCCAACCCGGTTGGATCGGTGACCGAGAGGCTGTAC
AACTCGGTGGTCGGCAAGACGTTCGGCTCAGACCGCGTGTTCTTCAGCGTCGCCGAGGCC
GTCGCGGCGGCGCCGCACAAAACACAGCCCTGA

Protein

671 aa

>Os06t0143700-01 Similar to Sulfate transporter 2.
MVVNNKVDSLSYDVEAPPAQAPTTPAVVSAPPTPRGEAPAMTTTAAAELHKVSVPERRST
AKALRQRLAEVFFPDDPLHQFKNQSSARRLVLALQYFFPIFHWGSDYSLRLLRSDVVSGL
TIASLAIPQGISYAKLANLPPIIGLYSSFVPPLIYSLLGSSRDLAVGPVSIASLVMGSML
RQAVSPDQEPILYLQLAFTSTFFAGVFQASLGFLRLGFIVDFLSKATLTGFMGGAAIIVS
LQQLKGLLGIIHFTSQMGFVQVMHSVFKHHDEWAWQTILMGVAFLAVLLTTRHISARNPK
LFWVSAAAPLTSVIISTIISFVSKAHGISVIGDLPKGLNPPSANMLTFSGSYVGLALNTG
IMTGILSLTEGIAVGRTFASINNYQVDGNKEMMAIGVMNMAGSCASCYVTTGSFSRSAVN
YSAGCKTAVSNIVMASAVLVTLLFLMPLFHYTPNVILSAIIITAVIGLIDVRGAARLWKV
DKLDFLACMAAFLGVLLVSVQMGLAIAVGISLFKILLQVTRPNMVVKGVVPGTASYRSMA
QYREAMRVPSFLVVGVESAIYFANSMYLGERIMRFLREEDERAAKCNQCPVRCIILDMSA
VAAIDTSGLDALAELKKVLEKRNIELVLANPVGSVTERLYNSVVGKTFGSDRVFFSVAEA
VAAAPHKTQP*

5'UTR

chr06:2298737..2298802 (- strand) : 66 bp

CDS

chr06:2298349..2298736 (- strand) : 388 bp

chr06:2298207..2298254 (- strand) : 48 bp

chr06:2297923..2298130 (- strand) : 208 bp

chr06:2297575..2297812 (- strand) : 238 bp

chr06:2295448..2295555 (- strand) : 108 bp

chr06:2295215..2295331 (- strand) : 117 bp

chr06:2294986..2295112 (- strand) : 127 bp

chr06:2293766..2294329 (- strand) : 564 bp

chr06:2293350..2293426 (- strand) : 77 bp

chr06:2293079..2293216 (- strand) : 138 bp

3'UTR

chr06:2292664..2293078 (- strand) : 415 bp

FASTA

>Os06t0143700-01 class=Sequence position=chr06:2292664..2298802 (- strand)
AAGCAGCCAA GGCGCCTCCC TTCCTAATCC TACCTCGATC GCCTCCTCCC TCTCGACTCG ATCGCCATGG TTGTCAACAA
CAAGGTGGAC AGCCTCTCCT acgacgtcga ggcgccaccg gcgcaggcgc cgacgacccc ggcggtggtc tccgcgccgc
cgacgccgcg gggcgaggcg ccggcgatga cgacgacggc ggcggcggag ctgcacaagg tgtcggtgcc ggagaggagg
tcgacggcga aggcgctgag gcagcggctg gcggaggtgT TCTTCCCCGA CGACCCGCTC CACCAGTTCA AGAACCAGTC
GTCCGCGCGG CGGCTGGTGC TCGCGCTGCA GTACTTCTTC CCCATCTTCC ATTGGGGCTC cgactacagc ctccgcctcc
tccgctccga cgtcgtctcc ggcctcacca ttgccagcct cGCCATCCCG CAGGCACGCA CGCAACCTGA TCACACATAC
ACGCCATTGT TTTGCCTCCT GAAATTCTCC ATTCCCAATT CCAATTCGAA TTCCGATTTC TTTGCAGGGA ATCAGCTACG
CCAAGCTCGC CAACCTGCCT CCAATCATTG GACTATGTAA GTAAAAGATG AACCAAAATG ACCGGCCATT ATGTCAATTC
GATGTGATGA ATAACACATA TGATGTATGC AGATTCGAGC TTCGTGCCGC CGCTGATCTA CTCGTTGTTG GGTAGCTCGC
GGGATCTGGC TGTAGGGCCG GTGTCGATAG CGTCGCTGGT GATGGGGTCG ATgctccggc aggcggtgtc gccggaccag
gagcccatcc tctacctcca gctcgccttc acctccacct tcttcgccgg cgtcttccaa gcctccctcg gcttcctccG
GTATTCGATC ACTTCACATC CATCATCTAC TGTTCCATTG ACGATGGATC GATGGATCGA TCACCTCATG CCTAGCTAAC
TGATGGAGTA TATCGTGTTC TTGGTTTTAG GCTGGGGTTC ATCGTGGATT TCTTGTCGAA GGCGACGCTG ACGGGATTCA
TGGGCGGCGC GGCGATCATC GTGTCGCTGC AGCAGCTCAA GGGATTGCTC GGGATCATCC ATTTCACGTC GCAGATGGGG
TTCGTCCAGG TGATGCACTC CGTCTTCAAG CACCACGACG AGTGGGCGTG GCAGACCATC CTCATGGGCG TCGCCTTCCT
CGCCGTCCTC CTCACCACAC GCCACATCGT AAGCTAATAG CTACCACACC TTCCTAGTAG CGTATCACCT GCAGAGATGA
TGCATGCTCT CTTGATTGAT TAGTTAATTA TTGCCTGTTC TTCGCTAATC GCGTGGTGAT TAGAAGGTAA TCAGGGGGTT
AATTGCTATT ACTATTTATA GAAAGTTCCG CAGAAATGGC TAGGCGCCAA AATAGTAAGG GAACCACAAT TAATAGCCAC
ACGTATGAAA TGCGTGGGGA TCAGGGATGC AAGCATGTCG ACCCATGAAC CTGCGTACAG GTTATTTAAA TGTTGCGCCT
AATAGAACAA TCTAGATATT TAGTGATTCA CAAGTAAAGT Gattttatag ttcttaagaa ggtattagaa gataccatat
tttttaatgt aaaatttgat acatcttgat atcttcgata ctaatagata ccaaaattta cactaaaata atcgatacct
cttggtatct ctcaaggatc gtaaaaGCTG GCCTGCCTTG CCTGTATAAG TAAAAATGTA ATGAGACCTG CCGTTGTAAA
TTCTGAGACA ATGGAAGAGT ACAGAACACT TTCGGCTAGG GGCAGTTATG AGCAGGACTA AATGGTTATT GTTAGTTAAT
TAGTCGGCAA AATTCTTTAT AATTATTTGA CCATGGTTAA AGACAGGTAA CTTATCTATA GCTAGGAAAG ATAGTATGGC
AAAAAGGAAA GGTGGTGATT AAAACCATTA CAAAGTGAGC TTCATGGAGG GGCCCAAAGG GTGCTTGCCA CTAACAAGGA
ATTTGACTCC ACTCAGTTAA ACTAATGGCC AATAGTTAAT GGAAGGTGAA GTTAAGCTAC CTCCAGCTTA TAGGGATCTC
ATAATGATGG GATATTTTGA TTTTTCCTAA AGGAATTCCA TTCACATAAT TGATTGTCGC GAAATTCGAA TATCTTACTT
TAGTAGTTGG GTGGTTTTCT TAATTAGGGG ATCACATAAA AGTTCCTCAA TTTTTTCAAA CTGTTTAAAC TTATTTAAGC
TAGTATAGTA CTACTTTAGG GTAATCTAAA AACTTCTTTA GACTTGCTTA ATAAACAGTT GCTATGCCAA GAAAAAGTCA
TGTCTTATGC CTAATCTTCC AAGATATCTG AACGTTGGAC TAACACATGG TGTCTAAAAA GTTAGTGTTG GCGTGTGACC
AGAAGTATTT AAGGTTGTTA ATTGCATAAT TGTGAAAGGA GTTTATAATA ATATTTACTC CCCTTACACT TGCAGAAAAG
CACTAATTCT TTTAGTAATT AATTAATCGA TCATGTGTAC AAAAACATAT GTCATGAAGC ACTCTAACTA GTATGATGAG
CAGTTCTAGT TTGGATGATC TCACAAACTA AACAAAAACA AAGAATGTTT ATATCTTGCA TTAGTCTTAA TACGATTAGA
CCATATACAT CAATTAAAGC AAGGCGTGTG TGTGGCTTTA GAATATATTC TAATAAAGCC ATTTTCAATT GGAACATTTC
TCTTTTCCCT TTTGGGAAGA ATGGATCTGG TTTGGCCACT CTGACGTGTC ACCTGTTAAG CTGGTTGTTC ACATGCTCAT
CTCTCTGAAT TTCGGTGTCT TTTCAGTCTA AACAGAATGA TCTGATAAAC ACATCCATTA GACTGTTAAT GGTTTTCCTC
TGAGAAAAGT AAGTCATCTG CTTTGTAATG ACGCTGTTCC TCACCTGGAA TGATTAAAAA GTGTCAATTA ATGCGACAAT
TCCACGGTCA TGGGACCATC TCAGAACAAT TCTTCAGAAG ATGTGAGGAG ATGGGGCCTG CCAAATTAAT AGGTTTTAAC
CAGAACTTCT TTTCATTTGT GATTCAAGAT CTACTGAACT CTTTTTATAA AAATTAAAAA AAAATATGTA CTGAATTCAT
TATGTGAACC GCTGTTGTGG TTGCCAATAA TTTTTTTACC TTCTGATTCT TCAGTTCGCT GTATACAATT TTCTCTGACT
TTGATGCGAG TATGCAGCCG GTAACAATTT TCACTGTATT TTTGCAGAGC GCCAGGAACC CAAAGCTTTT CTGGGTGTCA
GCAGCTGCTC CACTGACATC AGTGATCATC TCTACCATCA TCTCGTTCGT CAGCAAAGCT CATGGCATCA GTGTTGTGAG
TAGCTTCTCT AAACCATTTC TGAATCTTTC ATGGACAGCT TCACATCGAG AACATGAAAG AAACGTCATT AGTCACACTA
ATTCATCTTT TTTTGGGTGG TGTTTGGACA GATTGGCGAT CTCCCCAAGG GATTGAACCC TCCTTCAGCG AATATGCTGA
CCTTCAGTGG CTCCTACGTA GGACTGGCCT TAAACACAGG AATTATGACT GGCATACTAT CTCTCACTGT AAGGCACCTA
CATAAAAAAC ACATTTTATT TACTATCTGA ACTATTTTAG TATGGTGATG TTTAGTCTGA ACATGAAAGG AAAAATGACT
GAATTTGCAG GAAGGGATAG CAGTAGGCAG GACATTTGCA TCCATCAACA ACTACCAGGT TGATGGAAAC AAGGAGATGA
TGGCCATTGG TGTCATGAAC ATGGCTGGCT CATGTGCCTC CTGCTATGTC ACCACAGGTT GGTTTGTCAG TTGCACCATA
GCTTCTGAAC Gtattaagta cttgtcgttt tagataaaat tagatcaaac ctttaaaatt ctgaccatca gtaatttctt
aaatgcatag ttcaaaacca aaacaaacga tatagtatat agatttgcct cgaaaagtaa ttatcatagt attataaaat
gtttatattt tataaattta ctctaacata aaattaGCTG TCAAAATTTC AAAAGTTTGA CCAAATCTTA TACGATAAGT
ATCTTTTGAC CGGAGGTACt ctaacttgtt caagtttgtt taagtttaca gaaaatttta acaatatttt taatataaaa
taaatatgtt atcaaaatat attcaacgtt acattcaatg aaactaatta attcaatatt atagaaaaag attgactaaa
aaaaatcaaa acgacttata atatgaacgg aatgagggag taATATTCAT ATTTAGATAA TGGAAATGGA TTATATCTCC
GGCTTCTGTC ATGAGATGCA CAACAAAAAA AAAGACAAAG ATAAAAATAA ATCAAAATGA GAAATAAAAT GATGTGAGTA
ATATTCATAG AAGCTAGATG AGGATCGCAA TGGCTCACCA TTGGCAAAAA AAACTCTGAA TGAATGGACG CAGGATCGTT
CTCGAGGTCG GCGGTGAACT ACAGCGCGGG GTGCAAGACG GCGGTGTCGA ACATCGTGAT GGCGTCGGCG GTGCTGGTGA
CGCTGCTGTT CCTGATGCCG CTGTTCCACT ACACCCCCAA CGTGATCCTC TCGGCGATCA TCATCACCGC CGTGATCGGC
CTCATCGACG TCCGGGGCGC CGCCAGGCTG TGGAAGGTCG ACAAGCTCGA CTTCCTCGCC TGCATGGccg ccttcctcgg
cgtcctcctc gtctccgtcc agatgggcct cgccatcgcc gtcggcatct ccctcttcaa gatcctcctc CAGGTCACCC
GCCCAAACAT GGTGGTCAAG GGCGTCGTCC CCGGCACGGC GAGCTACCGG AGCATGGCGC AGTACAGGGA GGCCATGCGT
GTGCCGTCCT TCCTCGTCGT CGGCGTCGAG TCCGCCATCT ACTTCGCCAA CTCCATGTAC CTCGGCGAGA GGATCATGAG
GTTTCTCCGG GAGGAAGACG AGCGGGCCGC CAAGTGCAAC CAGTGCCCTG TCAGATGCAT CATCCTCGAC ATGAGTGGTA
ATAAGCTCTT GCATGCTACT ACTCCTGTAC AGAATTCATA CTCAGTTAAA AAAATGCTGA AAAGAGTGGT TAATTATTCA
GTAAATTAAA ACTGACATGG ATCGATGAGC TAATTATTCA TTCAGTACAA CGTTCTCAGA AAGATTGTAG TACAATCTTG
ATCAGTAAAA AGATTCTCAG TAAAAAGAGT TGTTAATTAT TCAGTAAAAA CTCACATGGA TCGATGAGCT AACTGTTCAG
TAAAAAGAGC AGCTAATTAT TCAGTATAAC ATTCTCAGAA TAATAGTACT ATCTTGTGAT CAGTACAAAC TGACAGAGAA
TTCGATGAAC TTGCAGCTGT TGCAGCGATC GACACGAGTG GCCTCGATGC ACTTGCAGAG CTGAAGAAGG TGCTGGAAAA
AAGAAACATC GAGGTAATAG AACTTCTGAA ACATCTATCT ACCAATGTTC TTCTTGTCAG TTTCAGTGAT TTACTATCAG
ATAATATTCA GATTTGTCAG TGACAGTGAA TAGTAACATG AGCTAATTTC TGACGGATTT CTGCAGCTTG TGCTGGCCAA
CCCGGTTGGA TCGGTGACCG AGAGGCTGTA CAACTCGGTG GTCGGCAAGA CGTTCGGCTC AGACCGCGTG TTCTTCAGCG
TCGCCGAGGC CGTCGCGGCG GCGCCGCACA AAACACAGCC CTGACAAGAG CAGAGATGTG CTTTGCTACC AGTAGATCCA
GCAGAAGCAG AAGTACTCTC TGACCAGCAG AAGCACAGTA GAACAAGGTG CTTCTCGGAG GAGGCTAATT AAAATTAAGA
ATCTTAAGAT AGAAGCGTAG AACAAGAAGA AGAAGAAGAA GAAGAAGAAG AAGAAGAAGA AGAAGAAGAA GAAGAAGGTG
GTAAAAAACA AGTCTATGGG CTGTTAATTT GTTCGCGTGT TGTGTTTAAT TAGGGGGGAT TATGGTAGTG CAGATGGGAA
ATAACTCCGG GTGCTGATCT CTTCTGATCG AGTTGGAAGA GTTTTTGAAG CATGTAACCA GAATGCGTGG CGTGTATGGT
GTAGCTTGTG ATTTGGTAGT TGTTGCAAAG TAATCCTTAA TGGAATCGGG TTTTGATCT

Locus: Os06g0143700

Loading...

Locus: Os06g0143700

Loading...