Os06t0144200-01

Locus

Os06g0144200

Description

Similar to Pectate lyase homolog (EC 4.2.2.2).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPLL6, PLL6

Oryzabase Gene Name Synonym(s)

Pectate lyase-like 6

Transcript Evidence

AK100191 (DDBJ, Best hit)

Protein Evidence

Q43862 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: pectate lyase activity (GO:0030570)

Functional domain (InterPro)

Pectate lyase/Amb allergen (IPR002022)

Parallel beta-helix repeat (IPR006626)

Pectate lyase, N-terminal (IPR007524)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

AmbAllergen (IPR018082)

Full-length cDNA

J023035P11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0144200-01)

RiceXPro (AK100191)

Others

Oryzabase (22491)

KEGG (Os06t0144200-01 (EC:4.2.2.2))

Transcript

1657 bp

>Os06t0144200-01 Similar to Pectate lyase homolog (EC 4.2.2.2).
GCCGGTGGTGCCATCGTCCGCACGTACGGCGTCCGTCACCCGGCTGGGAGGTCTCACGAA
ATTACGCACTTCCCTGAGACCTTCCCCGCGGTGACGCGTGCGTCGTCAGCCGGCGAGCCG
GACCACCACAAATAAAGGCATACATTGATACATATGGATATATATACGACATCACATCAC
AGCACAATAATGGCAgcctcctccgtcacggggagccgccgcctctgcattctcttctac
ctcctcactgtcgtcgccaccgtggtcaccgcggcgtcggcgcacacggcgcacaacgcc
accgccgacgaggagtactgggagaagcgcgccgaggaggcccgctcgttcaaccgcgcc
gcctacgtgagcgaccccgtcgccaccctgaaccgcttcaacgccgacgtgctccgcgcc
accacgcgccgctcgctggccaggtacaccggcccgtgcatggcgaccaaccccatcgac
cgctgctggcgctgccgcgacgactgggccaccgaccggaagcggctggcgcggtgcgtc
cgtgggttcggccacaggaccgtcggcggcgccgctggcaagatctacgtggtgaccgac
gccagcgacgacgagatggtcatcccgaggaaagggacgctccggtacggcgtgatccag
gaccggccgatgtggatcgtgttcgcgcgcgacatgatcatccagctccggcaggagctg
atcgtgaaccacaacaagaccatcgacggccgtggcgcgcaggtgcacatcaccggcgcc
cagatcacgctccagggcgtccagcatgtgatcatccacaacgtccacatccaccactcg
gtgccgcacggcggcggcatgatccgcgactccaagcgccactacggcctccgcacgcgc
agcgacggcgacggcatctccatcatgtcctcctccaacatctggatcgaccacgtctcc
atgtccaactgctccgacggcctcatcgacgccgtcagcggctccaccgccatcaccatc
tccaacggccacttcaccaagcacgaccaCGTCATGCTCTTCGGCGCCAGCAACAGCGAC
GCCCAGGACGAGGTGATGCAGATCACCGTGGCGTTCAACCACTTCGGCAAGGGCCTTGTG
CCGCGCTGCAGgttcggattcttccacgtcgtcaacaacgactacacgcactggctcatg
tacgccatcggtggcaacatgaacccgacgatcatcagccaggggaacaggttcatcgcg
cccgacgacttgaacgccaaggaggtgaccaagagggagtacacgccgtacgacgagtac
aaggagtgggtgtggaagtcgcagggcgacgtgatgatgaacggcgccttctttaacgag
tccggcggccagaacgagcgcagctacgaccagctcgacttcatccctgccaagcacggc
aagtacgtcggccagctcaccaagttcgccggcacgctcaactgccacgtcggcatgcca
tgctaATTAACTAGACATATCAGCAACGATATGGAAGAGGACGAGAGAAAGCTAATTAAC
CATGCCTTAATTTGTATATATATGAAAATCTGACAAATTTGTACATGTGTAAAACTTTAT
AATTCTCAAAAGAGAAAAAAAAACGTACATTATATAC

CDS

1353 bp

>Os06t0144200-01 Similar to Pectate lyase homolog (EC 4.2.2.2).
ATGGATATATATACGACATCACATCACAGCACAATAATGGCAgcctcctccgtcacgggg
agccgccgcctctgcattctcttctacctcctcactgtcgtcgccaccgtggtcaccgcg
gcgtcggcgcacacggcgcacaacgccaccgccgacgaggagtactgggagaagcgcgcc
gaggaggcccgctcgttcaaccgcgccgcctacgtgagcgaccccgtcgccaccctgaac
cgcttcaacgccgacgtgctccgcgccaccacgcgccgctcgctggccaggtacaccggc
ccgtgcatggcgaccaaccccatcgaccgctgctggcgctgccgcgacgactgggccacc
gaccggaagcggctggcgcggtgcgtccgtgggttcggccacaggaccgtcggcggcgcc
gctggcaagatctacgtggtgaccgacgccagcgacgacgagatggtcatcccgaggaaa
gggacgctccggtacggcgtgatccaggaccggccgatgtggatcgtgttcgcgcgcgac
atgatcatccagctccggcaggagctgatcgtgaaccacaacaagaccatcgacggccgt
ggcgcgcaggtgcacatcaccggcgcccagatcacgctccagggcgtccagcatgtgatc
atccacaacgtccacatccaccactcggtgccgcacggcggcggcatgatccgcgactcc
aagcgccactacggcctccgcacgcgcagcgacggcgacggcatctccatcatgtcctcc
tccaacatctggatcgaccacgtctccatgtccaactgctccgacggcctcatcgacgcc
gtcagcggctccaccgccatcaccatctccaacggccacttcaccaagcacgaccaCGTC
ATGCTCTTCGGCGCCAGCAACAGCGACGCCCAGGACGAGGTGATGCAGATCACCGTGGCG
TTCAACCACTTCGGCAAGGGCCTTGTGCCGCGCTGCAGgttcggattcttccacgtcgtc
aacaacgactacacgcactggctcatgtacgccatcggtggcaacatgaacccgacgatc
atcagccaggggaacaggttcatcgcgcccgacgacttgaacgccaaggaggtgaccaag
agggagtacacgccgtacgacgagtacaaggagtgggtgtggaagtcgcagggcgacgtg
atgatgaacggcgccttctttaacgagtccggcggccagaacgagcgcagctacgaccag
ctcgacttcatccctgccaagcacggcaagtacgtcggccagctcaccaagttcgccggc
acgctcaactgccacgtcggcatgccatgctaA

Protein

450 aa

>Os06t0144200-01 Similar to Pectate lyase homolog (EC 4.2.2.2).
MDIYTTSHHSTIMAASSVTGSRRLCILFYLLTVVATVVTAASAHTAHNATADEEYWEKRA
EEARSFNRAAYVSDPVATLNRFNADVLRATTRRSLARYTGPCMATNPIDRCWRCRDDWAT
DRKRLARCVRGFGHRTVGGAAGKIYVVTDASDDEMVIPRKGTLRYGVIQDRPMWIVFARD
MIIQLRQELIVNHNKTIDGRGAQVHITGAQITLQGVQHVIIHNVHIHHSVPHGGGMIRDS
KRHYGLRTRSDGDGISIMSSSNIWIDHVSMSNCSDGLIDAVSGSTAITISNGHFTKHDHV
MLFGASNSDAQDEVMQITVAFNHFGKGLVPRCRFGFFHVVNNDYTHWLMYAIGGNMNPTI
ISQGNRFIAPDDLNAKEVTKREYTPYDEYKEWVWKSQGDVMMNGAFFNESGGQNERSYDQ
LDFIPAKHGKYVGQLTKFAGTLNCHVGMPC*

5'UTR

chr06:2338036..2338188 (- strand) : 153 bp

CDS

chr06:2337038..2338035 (- strand) : 998 bp

chr06:2336585..2336939 (- strand) : 355 bp

3'UTR

chr06:2336434..2336584 (- strand) : 151 bp

FASTA

>Os06t0144200-01 class=Sequence position=chr06:2336434..2338188 (- strand)
GCCGGTGGTG CCATCGTCCG CACGTACGGC GTCCGTCACC CGGCTGGGAG GTCTCACGAA ATTACGCACT TCCCTGAGAC
CTTCCCCGCG GTGACGCGTG CGTCGTCAGC CGGCGAGCCG GACCACCACA AATAAAGGCA TACATTGATA CATATGGATA
TATATACGAC ATCACATCAC AGCACAATAA TGGCAgcctc ctccgtcacg gggagccgcc gcctctgcat tctcttctac
ctcctcactg tcgtcgccac cgtggtcacc gcggcgtcgg cgcacacggc gcacaacgcc accgccgacg aggagtactg
ggagaagcgc gccgaggagg cccgctcgtt caaccgcgcc gcctacgtga gcgaccccgt cgccaccctg aaccgcttca
acgccgacgt gctccgcgcc accacgcgcc gctcgctggc caggtacacc ggcccgtgca tggcgaccaa ccccatcgac
cgctgctggc gctgccgcga cgactgggcc accgaccgga agcggctggc gcggtgcgtc cgtgggttcg gccacaggac
cgtcggcggc gccgctggca agatctacgt ggtgaccgac gccagcgacg acgagatggt catcccgagg aaagggacgc
tccggtacgg cgtgatccag gaccggccga tgtggatcgt gttcgcgcgc gacatgatca tccagctccg gcaggagctg
atcgtgaacc acaacaagac catcgacggc cgtggcgcgc aggtgcacat caccggcgcc cagatcacgc tccagggcgt
ccagcatgtg atcatccaca acgtccacat ccaccactcg gtgccgcacg gcggcggcat gatccgcgac tccaagcgcc
actacggcct ccgcacgcgc agcgacggcg acggcatctc catcatgtcc tcctccaaca tctggatcga ccacgtctcc
atgtccaact gctccgacgg cctcatcgac gccgtcagcg gctccaccgc catcaccatc tccaacggcc acttcaccaa
gcacgaccaC GTCATGCTCT TCGGCGCCAG CAACAGCGAC GCCCAGGACG AGGTGATGCA GATCACCGTG GCGTTCAACC
ACTTCGGCAA GGGCCTTGTG CCGCGCTGCA GGTTCGGATT CTTCTTTTTA TTTTAAAGAA TTACACAGTA CAACGCACGC
ATACTCACTC CTATGAATGC ACGCACGTAA ACCCTACCTC TGTGAATagg ttcggattct tccacgtcgt caacaacgac
tacacgcact ggctcatgta cgccatcggt ggcaacatga acccgacgat catcagccag gggaacaggt tcatcgcgcc
cgacgacttg aacgccaagg aggtgaccaa gagggagtac acgccgtacg acgagtacaa ggagtgggtg tggaagtcgc
agggcgacgt gatgatgaac ggcgccttct ttaacgagtc cggcggccag aacgagcgca gctacgacca gctcgacttc
atccctgcca agcacggcaa gtacgtcggc cagctcacca agttcgccgg cacgctcaac tgccacgtcg gcatgccatg
ctaATTAACT AGACATATCA GCAACGATAT GGAAGAGGAC GAGAGAAAGC TAATTAACCA TGCCTTAATT TGTATATATA
TGAAAATCTG ACAAATTTGT ACATGTGTAA AACTTTATAA TTCTCAAAAG AGAAAAAAAA ACGTACATTA TATAC

Locus: Os06g0144200

Loading...

Locus: Os06g0144200

Loading...