Os06t0144900-01

Locus

Os06g0144900

Description

Pectate lyase/Amb allergen domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPLL7, PLL7

Oryzabase Gene Name Synonym(s)

Pectate lyase-like 7

Transcript Evidence

AK070509 (DDBJ, Best hit)

Protein Evidence

GeneMark

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: pectate lyase activity (GO:0030570)

Functional domain (InterPro)

Pectate lyase/Amb allergen (IPR002022)

Pectate lyase, N-terminal (IPR007524)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

AmbAllergen (IPR018082)

Full-length cDNA

J023054E18 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0144900-01)

Others

Oryzabase (22492)

Transcript

1867 bp

>Os06t0144900-01 Pectate lyase/Amb allergen domain containing protein.
tcggcggccggctcacctctctccgccgcccggcccgctcgctgatgctgccgccgccgg
cttcacgCGGGAAGAGGTCTCAGAAACCCTAGGCGAAAGCCGCCACACATTTCCTGAGTC
CTCTTTCCCGCGGTGCGGCGGCCGGCCGGGGCGGCGCTCCATACACCCATCGATCGTTCT
GAACCAGCAGGCATggcgggctccgtcgtgacgaggagcccactgtgctccatcctcttc
tacgtcctcgccacggccgccgcggcgacggcgacggcgacgcttgtgggcaacatcacc
gccgacgaggagtactgggccaagcgctccgaggtggcgcgctcgttcaaccgcgccgcc
tacgtcagcgaccccgtcgccgtgctgaacaggttcaacgaggacgtgctGAATACCACG
ACGGCGACGGCGGCGGCGGCGCGGCGGTCGCTGATGAGGAGGTACCGGCGTCGtggcccg
tgcacggtgacgaacccgatcgacctgtgctggcgctgccgcaagaactgggcgagccgt
cgcaagcggctggccaagtgcgccatggggttcggccacaaggccaccggcgggctcgcc
ggcaagatctacatcgtgacggacgccggcgacgagcacctcgtcatccctcggcggggc
acgctccggcacgccgtgatccaggagcggccgctgtggatcgtcttcgcgcggagcatg
gtgatcaggctcgccaaggagctcatcgtcaccagcgacaagaccatcgacggccgcggc
gcgcaggtgcacgtcaccggcgcgcagatcacggtgcaggcggtgagcaacgtcatcatc
cacaacctccacatccacaactccgtgccgcgctccggcggcctcatccgcgactccatg
caccacttcggcatccgcggcgagagcgacggcgacggcatctccgtcatgggctccagc
aacatctggatcgaccacgtctccatgtccaactgctccgacggcctcatcgacatcacc
gacggctccaccgccatcaccatctccaactcccacttcaccaagcacgatcacgtgatg
ctgttcggtgcacgcgacgactcgccgaaggacaagatcatgcaggtaacgctggcattc
aaccactttggcaaggggctcgtgcagaggatgccgaggtgcaggtttggattcttccac
atggtgaacaacgactacacgcactggctcatgtacgccatcggcggcaacatgaacccg
acgatcatcagccaggggaacaggttcagggcaagcgacgacatgaagctcaaggaggtg
accaagagggagtacacgagctacgacgagtacaaggagtgggtgtggaagtcgcaggac
gacctcttcctcaacggcgccttcttcaacgagtccggcggccggaacgagcgccggtac
aaccggctcgacctcatccaggccaggaacggccgctacgtcggccggatgaccaggttc
gccggcacgctgccatgccgtgtcggcaagaaatgctaggcatgcatatgcttgctactc
accgtgtgcgtgccaaggacatcatcatgatgatgcagatgcagagaggagaggaatttt
ccatgacgatcgcatggatatttatatgtatgaattatatttcatatatataatatggtt
cggcagtaatgcaatcatttgcaaaattgcataagccttagagaacagggttcgaaattt
tggaccaaaattttggtcatttcggtcctctccgatacgatattacttcgccgaaatttt
tcattttttcaattttttcatgaattttggtaatatttgttcaaattgaactaaattttg
tgatatc

CDS

1422 bp

>Os06t0144900-01 Pectate lyase/Amb allergen domain containing protein.
GTCCTCTTTCCCGCGGTGCGGCGGCCGGCCGGGGCGGCGCTCCATACACCCATCGATCGT
TCTGAACCAGCAGGCATggcgggctccgtcgtgacgaggagcccactgtgctccatcctc
ttctacgtcctcgccacggccgccgcggcgacggcgacggcgacgcttgtgggcaacatc
accgccgacgaggagtactgggccaagcgctccgaggtggcgcgctcgttcaaccgcgcc
gcctacgtcagcgaccccgtcgccgtgctgaacaggttcaacgaggacgtgctGAATACC
ACGACGGCGACGGCGGCGGCGGCGCGGCGGTCGCTGATGAGGAGGTACCGGCGTCGtggc
ccgtgcacggtgacgaacccgatcgacctgtgctggcgctgccgcaagaactgggcgagc
cgtcgcaagcggctggccaagtgcgccatggggttcggccacaaggccaccggcgggctc
gccggcaagatctacatcgtgacggacgccggcgacgagcacctcgtcatccctcggcgg
ggcacgctccggcacgccgtgatccaggagcggccgctgtggatcgtcttcgcgcggagc
atggtgatcaggctcgccaaggagctcatcgtcaccagcgacaagaccatcgacggccgc
ggcgcgcaggtgcacgtcaccggcgcgcagatcacggtgcaggcggtgagcaacgtcatc
atccacaacctccacatccacaactccgtgccgcgctccggcggcctcatccgcgactcc
atgcaccacttcggcatccgcggcgagagcgacggcgacggcatctccgtcatgggctcc
agcaacatctggatcgaccacgtctccatgtccaactgctccgacggcctcatcgacatc
accgacggctccaccgccatcaccatctccaactcccacttcaccaagcacgatcacgtg
atgctgttcggtgcacgcgacgactcgccgaaggacaagatcatgcaggtaacgctggca
ttcaaccactttggcaaggggctcgtgcagaggatgccgaggtgcaggtttggattcttc
cacatggtgaacaacgactacacgcactggctcatgtacgccatcggcggcaacatgaac
ccgacgatcatcagccaggggaacaggttcagggcaagcgacgacatgaagctcaaggag
gtgaccaagagggagtacacgagctacgacgagtacaaggagtgggtgtggaagtcgcag
gacgacctcttcctcaacggcgccttcttcaacgagtccggcggccggaacgagcgccgg
tacaaccggctcgacctcatccaggccaggaacggccgctacgtcggccggatgaccagg
ttcgccggcacgctgccatgccgtgtcggcaagaaatgctag

Protein

473 aa

>Os06t0144900-01 Pectate lyase/Amb allergen domain containing protein.
VLFPAVRRPAGAALHTPIDRSEPAGMAGSVVTRSPLCSILFYVLATAAAATATATLVGNI
TADEEYWAKRSEVARSFNRAAYVSDPVAVLNRFNEDVLNTTTATAAAARRSLMRRYRRRG
PCTVTNPIDLCWRCRKNWASRRKRLAKCAMGFGHKATGGLAGKIYIVTDAGDEHLVIPRR
GTLRHAVIQERPLWIVFARSMVIRLAKELIVTSDKTIDGRGAQVHVTGAQITVQAVSNVI
IHNLHIHNSVPRSGGLIRDSMHHFGIRGESDGDGISVMGSSNIWIDHVSMSNCSDGLIDI
TDGSTAITISNSHFTKHDHVMLFGARDDSPKDKIMQVTLAFNHFGKGLVQRMPRCRFGFF
HMVNNDYTHWLMYAIGGNMNPTIISQGNRFRASDDMKLKEVTKREYTSYDEYKEWVWKSQ
DDLFLNGAFFNESGGRNERRYNRLDLIQARNGRYVGRMTRFAGTLPCRVGKKC*

5'UTR

chr06:2372992..2373108 (+ strand) : 117 bp

CDS

chr06:2373109..2374065 (+ strand) : 957 bp

chr06:2374154..2374618 (+ strand) : 465 bp

3'UTR

chr06:2374619..2374946 (+ strand) : 328 bp

FASTA

>Os06t0144900-01 class=Sequence position=chr06:2372992..2374946 (+ strand)
tcggcggccg gctcacctct ctccgccgcc cggcccgctc gctgatgctg ccgccgccgg cttcacgCGG GAAGAGGTCT
CAGAAACCCT AGGCGAAAGC CGCCACACAT TTCCTGAGTC CTCTTTCCCG CGGTGCGGCG GCCGGCCGGG GCGGCGCTCC
ATACACCCAT CGATCGTTCT GAACCAGCAG GCATggcggg ctccgtcgtg acgaggagcc cactgtgctc catcctcttc
tacgtcctcg ccacggccgc cgcggcgacg gcgacggcga cgcttgtggg caacatcacc gccgacgagg agtactgggc
caagcgctcc gaggtggcgc gctcgttcaa ccgcgccgcc tacgtcagcg accccgtcgc cgtgctgaac aggttcaacg
aggacgtgct GAATACCACG ACGGCGACGG CGGCGGCGGC GCGGCGGTCG CTGATGAGGA GGTACCGGCG TCGtggcccg
tgcacggtga cgaacccgat cgacctgtgc tggcgctgcc gcaagaactg ggcgagccgt cgcaagcggc tggccaagtg
cgccatgggg ttcggccaca aggccaccgg cgggctcgcc ggcaagatct acatcgtgac ggacgccggc gacgagcacc
tcgtcatccc tcggcggggc acgctccggc acgccgtgat ccaggagcgg ccgctgtgga tcgtcttcgc gcggagcatg
gtgatcaggc tcgccaagga gctcatcgtc accagcgaca agaccatcga cggccgcggc gcgcaggtgc acgtcaccgg
cgcgcagatc acggtgcagg cggtgagcaa cgtcatcatc cacaacctcc acatccacaa ctccgtgccg cgctccggcg
gcctcatccg cgactccatg caccacttcg gcatccgcgg cgagagcgac ggcgacggca tctccgtcat gggctccagc
aacatctgga tcgaccacgt ctccatgtcc aactgctccg acggcctcat cgacatcacc gacggctcca ccgccatcac
catctccaac tcccacttca ccaagcacga tcacgtacac accccttctc catccatctt cttccacctt tcaccaatct
ctcgttaatg gactcgatcg attgatatgt ctcgtgttgc aggtgatgct gttcggtgca cgcgacgact cgccgaagga
caagatcatg caggtaacgc tggcattcaa ccactttggc aaggggctcg tgcagaggat gccgaggtgc aggtttggat
tcttccacat ggtgaacaac gactacacgc actggctcat gtacgccatc ggcggcaaca tgaacccgac gatcatcagc
caggggaaca ggttcagggc aagcgacgac atgaagctca aggaggtgac caagagggag tacacgagct acgacgagta
caaggagtgg gtgtggaagt cgcaggacga cctcttcctc aacggcgcct tcttcaacga gtccggcggc cggaacgagc
gccggtacaa ccggctcgac ctcatccagg ccaggaacgg ccgctacgtc ggccggatga ccaggttcgc cggcacgctg
ccatgccgtg tcggcaagaa atgctaggca tgcatatgct tgctactcac cgtgtgcgtg ccaaggacat catcatgatg
atgcagatgc agagaggaga ggaattttcc atgacgatcg catggatatt tatatgtatg aattatattt catatatata
atatggttcg gcagtaatgc aatcatttgc aaaattgcat aagccttaga gaacagggtt cgaaattttg gaccaaaatt
ttggtcattt cggtcctctc cgatacgata ttacttcgcc gaaatttttc attttttcaa ttttttcatg aattttggta
atatttgttc aaattgaact aaattttgtg atatc

Locus: Os06g0144900

Loading...

Locus: Os06g0144900

Loading...