Os06t0147800-01

Locus

Os06g0147800

Description

Mitogen-activated protein kinase (MAPK) kinase, Regulation of salt stress tolerance

RAP-DB Gene Symbol Synonym(s)

OsMKK1

RAP-DB Gene Name Synonym(s)

Mitogen-activated protein kinase kinase 1

CGSNL Gene Symbol

MKK1

CGSNL Gene Name

MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1

Oryzabase Gene Symbol Synonym(s)

OsMKK1, OsMEK2, MEK2

Oryzabase Gene Name Synonym(s)

MAPK kinase 1

Transcript Evidence

AK111598

Protein Evidence

Q5VP37

Literature

PMID: 25219319

Note

Manual Curation

October 16, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase, catalytic domain (IPR001245)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J013094D16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0147800-01)

RiceXPro (AK111598)

Others

Oryzabase (8829)

KEGG (Os06t0147800-01 (EC:2.7.12.2))

Transcript

1525 bp

>Os06t0147800-01 Mitogen-activated protein kinase (MAPK) kinase, Regulation of salt stress tolerance
GTCTCCATTTCGCGTCTCCTCCTCCTCCTCCTCCGGCCATCTCACCCTCCCGGCGAGCAG
CGAGCGGGAGGCCTCCGCCACCGCCGCCGCCGCCGCCGCCGTCGCCGCCCGATGGGGAAG
CCGGGGAAGCTAGCGCTGCCCTCGCACGAGTCAACCATCGGCAAATTCCTGACGCAGAGC
GGGACGTTCAAGGACGGCGATCTGCTCGTCAACAAGGACGGCCTCCGCATCGTCTCGCAG
AGCGAGGAAGGGGAGGCCCCTCCTATAGAACCTTTAGATCATAATCAGTTGAGTCTAGAT
GATCTAGACGCAATCAAAGTTATCGGTAAAGGTAGTAGTGGAATCGTGCAGTTGGTTCGC
CACAAATGGACTGGCCAGTTTTTTGCTCTGAAGGTAATACAACTCAATATCCAGGAGAAT
ATACGCAGACAGATTGCGCAGGAATTGAAAATCAGCTTGTCAACACAGTGCCAATATGTT
GTTGCATGCTGTCAGTGTTTTTACGTTAATGGTGTCATTTCAATTGTTTTGGAGTATATG
GACAGTGGCTCTCTCTCAGATTTCCTGAAGACAGTTAAAACCATTCCAGAGCCCTACCTT
GCTGCAATCTGTAAGCAGGTGCTAAAAGGACTGATGTACTTACATCATGAGAAGCACATC
ATACACCGAGATCTGAAGCCGTCAAATATATTAATAAATCATATGGGTGAAGTAAAAATA
TCCGACTTTGGTGTTAGTGCCATCATTGCTAGTTCCTCGGCACAACGAGATACATTTACT
GGGACATATAACTACATGGCGCCAGAAAGAATCAGTGGGCAAAAACATGGTTATATGAGT
GATATCTGGAGCTTGGGCCTCGTTATGCTAGAATTGGCCACTGGTGAATTTCCATATCCT
CCTCGTGAAAGCTTTTATGAACTCCTTGAAGCTGTTGTCGACCACCCACCACCTTCTGCT
CCATCAGACCAGTTTTCAGAGGAATTCTGTTCATTCGTCTCTGCATGTATCCAAAAGAAT
GCTTCGGATAGGTCATCTGCACAAATCTTATTAAATCATCCATTCCTGAGCATGTATGAC
GACCTGAATATAGATCTTGCTTCGTACTTCACAACCGATGGATCTCCGCTTGCCACCTTC
AATACAAGCAACCGATATGATGACAGATAGTCTGATGCAACACTGCGTCATCATCTAGCT
CGAAGGATGATCCTTTGGCTGTCCATCTGTAGAATCTACCATCTACCTAACTGGCCCCAA
ATGTTTCGTGTATTTTTTGGGAGAAAACTTTGCCCTGTGTACTGAGCTGGGATTGATGTC
TTTGATATGTAAATTTCGCGTAATTTCATATGTAGAACAATTCTAGGATCATTGGGCATT
GAAGTTTTGTTTGGCCGTGCACCAGGATGATCTGTTCTTGATCGCTTTACCTTTGTTTCT
CACTTCTGTAACTAAAACCTATATTTACCATTTACCGGATTGTTCATGGCCTCTTCTGGG
CAAGTCGGTGTCGACTGAAAGTCTC

CDS

1059 bp

>Os06t0147800-01 Mitogen-activated protein kinase (MAPK) kinase, Regulation of salt stress tolerance
ATGGGGAAGCCGGGGAAGCTAGCGCTGCCCTCGCACGAGTCAACCATCGGCAAATTCCTG
ACGCAGAGCGGGACGTTCAAGGACGGCGATCTGCTCGTCAACAAGGACGGCCTCCGCATC
GTCTCGCAGAGCGAGGAAGGGGAGGCCCCTCCTATAGAACCTTTAGATCATAATCAGTTG
AGTCTAGATGATCTAGACGCAATCAAAGTTATCGGTAAAGGTAGTAGTGGAATCGTGCAG
TTGGTTCGCCACAAATGGACTGGCCAGTTTTTTGCTCTGAAGGTAATACAACTCAATATC
CAGGAGAATATACGCAGACAGATTGCGCAGGAATTGAAAATCAGCTTGTCAACACAGTGC
CAATATGTTGTTGCATGCTGTCAGTGTTTTTACGTTAATGGTGTCATTTCAATTGTTTTG
GAGTATATGGACAGTGGCTCTCTCTCAGATTTCCTGAAGACAGTTAAAACCATTCCAGAG
CCCTACCTTGCTGCAATCTGTAAGCAGGTGCTAAAAGGACTGATGTACTTACATCATGAG
AAGCACATCATACACCGAGATCTGAAGCCGTCAAATATATTAATAAATCATATGGGTGAA
GTAAAAATATCCGACTTTGGTGTTAGTGCCATCATTGCTAGTTCCTCGGCACAACGAGAT
ACATTTACTGGGACATATAACTACATGGCGCCAGAAAGAATCAGTGGGCAAAAACATGGT
TATATGAGTGATATCTGGAGCTTGGGCCTCGTTATGCTAGAATTGGCCACTGGTGAATTT
CCATATCCTCCTCGTGAAAGCTTTTATGAACTCCTTGAAGCTGTTGTCGACCACCCACCA
CCTTCTGCTCCATCAGACCAGTTTTCAGAGGAATTCTGTTCATTCGTCTCTGCATGTATC
CAAAAGAATGCTTCGGATAGGTCATCTGCACAAATCTTATTAAATCATCCATTCCTGAGC
ATGTATGACGACCTGAATATAGATCTTGCTTCGTACTTCACAACCGATGGATCTCCGCTT
GCCACCTTCAATACAAGCAACCGATATGATGACAGATAG

Protein

353 aa

>Os06t0147800-01 Mitogen-activated protein kinase (MAPK) kinase, Regulation of salt stress tolerance
MGKPGKLALPSHESTIGKFLTQSGTFKDGDLLVNKDGLRIVSQSEEGEAPPIEPLDHNQL
SLDDLDAIKVIGKGSSGIVQLVRHKWTGQFFALKVIQLNIQENIRRQIAQELKISLSTQC
QYVVACCQCFYVNGVISIVLEYMDSGSLSDFLKTVKTIPEPYLAAICKQVLKGLMYLHHE
KHIIHRDLKPSNILINHMGEVKISDFGVSAIIASSSAQRDTFTGTYNYMAPERISGQKHG
YMSDIWSLGLVMLELATGEFPYPPRESFYELLEAVVDHPPPSAPSDQFSEEFCSFVSACI
QKNASDRSSAQILLNHPFLSMYDDLNIDLASYFTTDGSPLATFNTSNRYDDR*

5'UTR

chr06:2502777..2502887 (- strand) : 111 bp

CDS

chr06:2502718..2502776 (- strand) : 59 bp

chr06:2502490..2502574 (- strand) : 85 bp

chr06:2501690..2501827 (- strand) : 138 bp

chr06:2501267..2501492 (- strand) : 226 bp

chr06:2500978..2501159 (- strand) : 182 bp

chr06:2500667..2500872 (- strand) : 206 bp

chr06:2499567..2499612 (- strand) : 46 bp

chr06:2499371..2499464 (- strand) : 94 bp

chr06:2499218..2499240 (- strand) : 23 bp

3'UTR

chr06:2498863..2499217 (- strand) : 355 bp

FASTA

>Os06t0147800-01 class=Sequence position=chr06:2498863..2502887 (- strand)
GTCTCCATTT CGCGTCTCCT CCTCCTCCTC CTCCGGCCAT CTCACCCTCC CGGCGAGCAG CGAGCGGGAG GCCTCCGCCA
CCGCCGCCGC CGCCGCCGCC GTCGCCGCCC GATGGGGAAG CCGGGGAAGC TAGCGCTGCC CTCGCACGAG TCAACCATCG
GCAAATTCCT GTGATCTCCC GTTCCCCCCA TCTCTCTCTC TCCCGCTTTT CCGTGTCCTC TGCTGCTCGC ATCACGCTTG
CTGTTGTTGT TGGATGTGTG TTGCTTGTGC TGATTCCGGT GGTGTTTCGG GGGTTTGGGT TTTCGGGCTG CAGGACGCAG
AGCGGGACGT TCAAGGACGG CGATCTGCTC GTCAACAAGG ACGGCCTCCG CATCGTCTCG CAGAGCGAGG AAGGGGAGGT
AAAGTCACCA GCGGAAATGA TATAGTTTCA CCTGTTTGGT ATTCCGTTTG GCAATCGTAG GAGTGAACTC GCCATGGTTG
GATCTTCTCT TGGGTTTTGT TGAGGAGATG AAGGTGTGAA TTGGATGATG GGCGGGTCGC TAGCGGCGTT CCTGGATTCA
CTCTGGAGTG AATTGTTGTT GAGCTCTGAT TATATTCTGG ATTGGAATGT CATGCGTTTG GCAATCAGGG TGCTGTTTGC
CTGTTTGGTA ATAGGGCAGA TGCATACGCT AATTTTCTAC ATTAAAATGT GCCAATAATT TGCAACCATT TTTATATGGT
AGTGAAGAAA TCCTGAAATA GTTTAATTCA CATTTTCTAA TCCACAGCGA ACTAGGATAG GAAACAGCAT GCCTTTTTAT
CTTCATTGTT TCGATGAGCG TCATACTTAT ATAGTGGTTT CTCATGTGGA GTGTCTAGAC ACTAACTAGT GGTATCTGCA
TATGCAATAA ATTACTGAAA GCATATATGC TGCATCTGGT AGCTCTGTTC CTGGTGCTCA CTTATAGTGT GAGAATGTTC
TTTAATACTA TCATTACTTT TTGTACTCTC CATTCATTTA ATATGTTCTT TTATTTTGTG TACTCACCTT CTCTCTATTG
GCATGCTAAA ATTGTTGCAG GCCCCTCCTA TAGAACCTTT AGATCATAAT CAGTTGAGTC TAGATGATCT AGACGCAATC
AAAGTTATCG GTAAAGGTAG TAGTGGAATC GTGCAGTTGG TTCGCCACAA ATGGACTGGC CAGTTTTTTG CTCTGAAGGT
ATTATATGAA AGTACATTCT TTGCTTTTTA TGATTTCTTC CACTCTCCCC TTACCAGTTT TAACTACAAT CTTTTTAGTG
TTCCCAATAG TTATAGCTTC ATGTGAGTCC AGTGTTTTTT CATGTGGTCT TTTGCCTAAC ACTTGCAAAG GATCTTTAGT
TCTTTACCTC CATTGATATA TTATTGCGTT TACAGGTAAT ACAACTCAAT ATCCAGGAGA ATATACGCAG ACAGATTGCG
CAGGAATTGA AAATCAGCTT GTCAACACAG TGCCAATATG TTGTTGCATG CTGTCAGTGT TTTTACGTTA ATGGTGTCAT
TTCAATTGTT TTGGAGTATA TGGACAGTGG CTCTCTCTCA GATTTCCTGA AGACAGTTAA AACCATTCCA GAGCCCTACC
TTGCTGCAAT CTGTAAGCAG GCCAGTGACA TGTGGTAGAA GCTATCACAC AATTTCTTTG CTTTGCAAAT GTTACTTAAG
CACCACATGG ACTTTATAAT AAAAATAAAT AAATCTTTCC TGCGCAGGTG CTAAAAGGAC TGATGTACTT ACATCATGAG
AAGCACATCA TACACCGAGA TCTGAAGCCG TCAAATATAT TAATAAATCA TATGGGTGAA GTAAAAATAT CCGACTTTGG
TGTTAGTGCC ATCATTGCTA GTTCCTCGGC ACAACGAGAT ACATTTACTG GGACATATAA CTACATGGCG GTGCGTAAAA
GTTTCTGTGT CATGAAATGT ATCTCTGATT ATTGCATGAA ATGCTATCTA TTTTGTTTGT CTTGTTGAAC CAAAGGGAAA
TTCTGTTCTT GACAGCCAGA AAGAATCAGT GGGCAAAAAC ATGGTTATAT GAGTGATATC TGGAGCTTGG GCCTCGTTAT
GCTAGAATTG GCCACTGGTG AATTTCCATA TCCTCCTCGT GAAAGCTTTT ATGAACTCCT TGAAGCTGTT GTCGACCACC
CACCACCTTC TGCTCCATCA GACCAGTTTT CAGAGGAATT CTGTTCATTC GTCTCTGCAT GGTAATTGTA CTTCTTTGAT
GATTTCTCTT ATCCACTTAC ATTTGCAGTA CTAGCAATTT GTTTTAATTT TTAGTTTACA ATCACGTGCT TCTAATATCC
CAAGTTGGTG CCTGTTTTAT ACATTTTACA TGCAAAATTT AAGTGAAAAG GTGACTACCT TCAGAGTGTG TTTGGTACCC
TGTATGTCAT TCAGCCTGGC TTGCATCAGC AGAGCTTGCC CAACCAGTCC TGTGTAGATG CTGAAAATTG ACAAGTTTAG
TTACATGCTT TTGCTTAGCT AGGCCATGTA GGGAGTTTGT TTGGTTTACA GCATGTATAC GTGCAAAGCC CAAAATATAT
CTTTGGAGCC AGTGCATGCC AGCAATTTCG TGCTCTCACC AGCAGGCCAG CAGGAAACGG ATTCTGAATA CGGAAAACGT
TTCTATGGGG CCATGCCCAT ACCTCACTTT GGAATGCGCA GGGATTGGCC CATCCAATCA CACAGAAAAC CAAACATTGG
AACTGTTCCA GGGAACAAAT GCCCCCTTAC TGCCTTGGTA TGCAGATTGT AGGGACCCAA TTGATGCATG GCGGGATTAC
ACCCAACTAA ATCATTTATT GTGTGGCGTG TTCCATActc cctccatact tataaaggaa gtcgtttagg acaatattta
agtcaaacct tgagaatata aatcgtgaat aactctcaag ttgttgagtt tgaaaatata aaaattatat gtatagattt
gtcttgaaaa atactttcat aaaagtatgc atatatcact ttttaataaa tatttttata gaaataagaa gtcaaatttg
tgttttggag accgtgttgc tttcctaaac gactttcttt acgagtatgg agggagTACT TCTTTTCTTG AGATATTTTT
GTTACTCTTA CATGTGAACC AAATAGGTCT AATGTCTTTC AACTCTTCAT ATTCATATGG ACTTTCAATG TTAAGAAGGC
TGCTAAGTTT TATAAAGGGA AATAAATAAA TAAACAGGGC TAATACAGTT CCTCTGTCTG TTCTGTGGGT TGCAGTATCC
AAAAGAATGC TTCGGATAGG TCATCTGCAC AAATCTTATT AGTAAGTGAA AATTCTTATC CACGCTGTTC TTTTTAAGGC
ATCTTTTGCA CAAGTCTAGC TCACTGATCT TGTTGCGTCC TCCCTCTGCT CTTTGATACC CAGAATCATC CATTCCTGAG
CATGTATGAC GACCTGAATA TAGATCTTGC TTCGTACTTC ACAACCGATG GATCTCCGCT TGCCACCTTC AATACAAGTA
ATGATGAGCA ACTTGTCTTT TTTCTTTGTT TTTGCCATCC ATTTTGTCAT AGACACATGT TAGTGCCATT CTTTATGATT
CCAGTGGATG AACCATCAAG GGAACCTTAC ATTCTTTTTT TTCGTAGGCA ACCGATATGA TGACAGATAG TCTGATGCAA
CACTGCGTCA TCATCTAGCT CGAAGGATGA TCCTTTGGCT GTCCATCTGT AGAATCTACC ATCTACCTAA CTGGCCCCAA
ATGTTTCGTG TATTTTTTGG GAGAAAACTT TGCCCTGTGT ACTGAGCTGG GATTGATGTC TTTGATATGT AAATTTCGCG
TAATTTCATA TGTAGAACAA TTCTAGGATC ATTGGGCATT GAAGTTTTGT TTGGCCGTGC ACCAGGATGA TCTGTTCTTG
ATCGCTTTAC CTTTGTTTCT CACTTCTGTA ACTAAAACCT ATATTTACCA TTTACCGGAT TGTTCATGGC CTCTTCTGGG
CAAGTCGGTG TCGACTGAAA GTCTC

Locus: Os06g0147800

Loading...

Locus: Os06g0147800

Loading...