Os06t0149400-01

Locus

Os06g0149400

Description

Similar to Chitinase A.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Orysa;NAP1;1, OsNAP1_L1

Oryzabase Gene Name Synonym(s)

nucleosome assembly protein 1-like protein 1, Nucleosome assembly protein 1;1, NAP1-like protein 1

Transcript Evidence

AK071177 (DDBJ, Best hit)

Protein Evidence

Q70Z21 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: nucleosome assembly (GO:0006334)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

Nucleosome assembly protein (NAP) (IPR002164)

Full-length cDNA

J023084M16 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0149400-01)

RiceXPro (AK071177)

Others

Oryzabase (14083)

KEGG (Os06t0149400-01)

Transcript

1562 bp

>Os06t0149400-01 Similar to Chitinase A.
GTGGCTTCCCCTTTCTCTCTCTCTCTCTCTCTCTCTCCCTTCGCTTTCTCTCTTCCTTCC
TAGGGCTTCCCCTCCTCGGCGGCGCATCGCATAGGCGGCGGACGAAGAGCTCCCGGCGAT
GGGCGGCGACAAGGAGAACCTCGACCTCTCCGACCTCAACGCCTCGCTGCCCGCCGCCGC
CGCCGCTCTCAGCGCCGAGGACCGCGCCGGCCTCGTCAATGCCCTGAAGGATAAGCTGCA
GAGCTTGGCGGGTCAGCACACGGACGTGCTTGAGGCGCTCTCCCCCAATGTCAGGAAGCG
TGTCGAATATTTGAGGGAGATCCAGGGCCAGCATGATGAAATCGAGTTAAAATTCTTTGA
AGAGAGAGCTGCGCTTGAAGCGAAGTACCAGAAGCTTTATGAACCCTTGTACACAAAGAG
GTATAACATAGTAAATGGAGTTGTTGAGGTTGATGGTGGAAATGACGAACCAGCCAGTGA
AAATGCTGCTGAGGGTAAAGATGCAGATGCTAAAGGAGTCCCAGATTTTTGGCTTACTGC
TATGAAAACAAATGAAGTGCTTTCTGAGGAGATCCAAGAGCGTGACGAGCCTGCTTTGAA
ATATCTGAAAGATATCAAGTGGGCTAGAATTGACGATCCTAAGGGTTTCAAGCTGGATTT
TTTCTTTGATACGAACCCTTTCTTCAAGAACTCTGTCCTAACAAAAACGTACCACATGGT
TGATGAAGATGAACCAATTTTGGAGAAAGCAATTGGGACTGAAATTGAGTGGTATCCTGG
TAAAAACCTGACACAGAAGATTCTAAAAAAGAAACCCAAGAAAGGTTCAAAGAATGCAAA
GCCTATTACCAAAACTGAAGTCTGTGAGAGCTTCTTCAACTTTTTCAGTCCCCCGCAAGT
ACCCGATGATGATGAGGACATTGATGAAGACACTGCTGATGAGCTTCAGGGTCAAATGGA
ACATGATTATGACATTGGGACCACCATAAGGGATAAGATCATCCCACATGCTGTTTCCTG
GTTTACTGGTGAGGCTGTGCAAGCCGAGGATTTTGACGATATGGAGGATGATGAAGAAGA
TGATGAAGACGATGATGAAGATGAGGAGGAGGAAGAAGAGGATGAGGATGAAGACGAAGA
CGATGAGGAAGAAAAAAGCAAGCCAAAGAAGAAGTCGGCAGGCAAACCGAAGCTACCATC
GAAGGGCGGGGCACAAGGAGGTGCTGATCAACCAGCAGATTGCAAGCAGCAGTAGAACTG
TTGTGGTTCACAGCGCCACGTGAGCTGTTTGTTATTTTGTTGATGCAGTATTTTGCGTTG
AACTGCCCAGGAAATTATTGGTTGGTTGTGCACGGGTGAGGTTTCGTTGCTGGTATATGT
TACCCGTGGTTTTATTGGCGAAGTTGTGAGGCCTGTCTGGAACATCTATATTAGAGTATT
ATTATGTTTTAGTTATATGTAATCGGTTTATTAAGTTTGTGTAATTATCTGGAATCTGCC
GGTGGAACTTTTACTAGTATTCATTTGAGCCTTATGGAAAAAAAATGAAATATGTCTTAT
GG

CDS

1137 bp

>Os06t0149400-01 Similar to Chitinase A.
ATGGGCGGCGACAAGGAGAACCTCGACCTCTCCGACCTCAACGCCTCGCTGCCCGCCGCC
GCCGCCGCTCTCAGCGCCGAGGACCGCGCCGGCCTCGTCAATGCCCTGAAGGATAAGCTG
CAGAGCTTGGCGGGTCAGCACACGGACGTGCTTGAGGCGCTCTCCCCCAATGTCAGGAAG
CGTGTCGAATATTTGAGGGAGATCCAGGGCCAGCATGATGAAATCGAGTTAAAATTCTTT
GAAGAGAGAGCTGCGCTTGAAGCGAAGTACCAGAAGCTTTATGAACCCTTGTACACAAAG
AGGTATAACATAGTAAATGGAGTTGTTGAGGTTGATGGTGGAAATGACGAACCAGCCAGT
GAAAATGCTGCTGAGGGTAAAGATGCAGATGCTAAAGGAGTCCCAGATTTTTGGCTTACT
GCTATGAAAACAAATGAAGTGCTTTCTGAGGAGATCCAAGAGCGTGACGAGCCTGCTTTG
AAATATCTGAAAGATATCAAGTGGGCTAGAATTGACGATCCTAAGGGTTTCAAGCTGGAT
TTTTTCTTTGATACGAACCCTTTCTTCAAGAACTCTGTCCTAACAAAAACGTACCACATG
GTTGATGAAGATGAACCAATTTTGGAGAAAGCAATTGGGACTGAAATTGAGTGGTATCCT
GGTAAAAACCTGACACAGAAGATTCTAAAAAAGAAACCCAAGAAAGGTTCAAAGAATGCA
AAGCCTATTACCAAAACTGAAGTCTGTGAGAGCTTCTTCAACTTTTTCAGTCCCCCGCAA
GTACCCGATGATGATGAGGACATTGATGAAGACACTGCTGATGAGCTTCAGGGTCAAATG
GAACATGATTATGACATTGGGACCACCATAAGGGATAAGATCATCCCACATGCTGTTTCC
TGGTTTACTGGTGAGGCTGTGCAAGCCGAGGATTTTGACGATATGGAGGATGATGAAGAA
GATGATGAAGACGATGATGAAGATGAGGAGGAGGAAGAAGAGGATGAGGATGAAGACGAA
GACGATGAGGAAGAAAAAAGCAAGCCAAAGAAGAAGTCGGCAGGCAAACCGAAGCTACCA
TCGAAGGGCGGGGCACAAGGAGGTGCTGATCAACCAGCAGATTGCAAGCAGCAGTAG

Protein

379 aa

>Os06t0149400-01 Similar to Chitinase A.
MGGDKENLDLSDLNASLPAAAAALSAEDRAGLVNALKDKLQSLAGQHTDVLEALSPNVRK
RVEYLREIQGQHDEIELKFFEERAALEAKYQKLYEPLYTKRYNIVNGVVEVDGGNDEPAS
ENAAEGKDADAKGVPDFWLTAMKTNEVLSEEIQERDEPALKYLKDIKWARIDDPKGFKLD
FFFDTNPFFKNSVLTKTYHMVDEDEPILEKAIGTEIEWYPGKNLTQKILKKKPKKGSKNA
KPITKTEVCESFFNFFSPPQVPDDDEDIDEDTADELQGQMEHDYDIGTTIRDKIIPHAVS
WFTGEAVQAEDFDDMEDDEEDDEDDDEDEEEEEEDEDEDEDDEEEKSKPKKKSAGKPKLP
SKGGAQGGADQPADCKQQ*

5'UTR

chr06:2558017..2558134 (+ strand) : 118 bp

CDS

chr06:2558135..2558201 (+ strand) : 67 bp

chr06:2558280..2558323 (+ strand) : 44 bp

chr06:2558441..2558536 (+ strand) : 96 bp

chr06:2560267..2560359 (+ strand) : 93 bp

chr06:2560458..2560548 (+ strand) : 91 bp

chr06:2560625..2560686 (+ strand) : 62 bp

chr06:2560762..2560946 (+ strand) : 185 bp

chr06:2561030..2561207 (+ strand) : 178 bp

chr06:2561301..2561344 (+ strand) : 44 bp

chr06:2561448..2561643 (+ strand) : 196 bp

chr06:2561736..2561753 (+ strand) : 18 bp

chr06:2561847..2561909 (+ strand) : 63 bp

3'UTR

chr06:2561910..2562216 (+ strand) : 307 bp

FASTA

>Os06t0149400-01 class=Sequence position=chr06:2558017..2562216 (+ strand)
GTGGCTTCCC CTTTCTCTCT CTCTCTCTCT CTCTCTCCCT TCGCTTTCTC TCTTCCTTCC TAGGGCTTCC CCTCCTCGGC
GGCGCATCGC ATAGGCGGCG GACGAAGAGC TCCCGGCGAT GGGCGGCGAC AAGGAGAACC TCGACCTCTC CGACCTCAAC
GCCTCGCTGC CCGCCGCCGC CGCCGGTAAG CTCACGCGCT CGCGGGGTCT TATCCTGTCG TCTCCTTTAT TTGTTTCCTG
ATCGATCCGT GTTTTGGCCG CAGCTCTCAG CGCCGAGGAC CGCGCCGGCC TCGTCAATGC CCTGAAGGTG AGACGATTTG
GATCGATTTT GAGGCGCTAT TCGATTCGGG AGCGGGGGGC GTGGTTGGTT GATTTTTGGT ACCTGTTAGT TTTTCTCATC
CCGTGTGGTC TGATTCGGTT GCAGGATAAG CTGCAGAGCT TGGCGGGTCA GCACACGGAC GTGCTTGAGG CGCTCTCCCC
CAATGTCAGG AAGCGTGTCG AATATTTGAG GGAGATCCAG GTGGGCATGG AATTTCCTTG CCACTAATTT TCCCGTTTCT
AATGTGAATA CTTTGCCAGA TGTTGTTGTG TTAGAATATT ATAATCAATG GTATAGCTGT TAGATTTAGC TTCTGGTAGG
CACTGATTTG TAAGGATCTC ATTAGTCAGC CTTATCTGTA CTGCTGCTTT TTTATTAGTG CTCCTTAATT TTGTAATGAC
TAGAAAAAAC ACCCATGCTT TGCTATGGAT AAAAGAAAGT ATATTATAAT ATGTAATAGA TATTAAAACA TTGTCAAATA
TGTTAGTATC ACTTGTTTAC TTGTTTGAAC CGAATATTTG GACTATTCCA TAATATCAAA AGATATCAGG AGCCAATTTG
TGGTGGGTGG CAGATTCACT GGCACCACCA CTAGGGACTT TTAAAGGAGT ATAGATTCTG TAAAGAAAAA TAGTTTTAGC
CAAAAAAAAG TTCTGAGCAT TACGTATATG TAATATTCAT GTTAAGGAAG GAGCTAGATG ATGGTAATCA GGCTTTATTA
TGTCTGTCAG GTGTCGAATA TTTATCTCTG GCCTATTCAA AGATGTTCAA TAGTCACCAT TTGTTTGGTT GTGGTAGTAG
CTGATGGGTA ACATCAGAAT GACCTGTTCA TCATCTTGGA GGATATCAAT ATGCTTTATC TATGCTGTAA AATTTTATCT
CTTTAAATTT ATGGAACTTC TGTTGGATAT GACAATAATT CAAGAGTGAT GTTGATCATG GAATTCTCCT TTTGAATTGA
ATAAGTAAAG ATATTCCTTA TAAGGGGTCA TATTGGTAGA ACAGTAGGAT TGGGATTAGG ATATGGTTTA GGCTTATCCC
AGCTATCTTC CTTTCACCAA GTCCTCCTTC CTAACCCTCC ATCTCTATCC CACTTCTACC ATGAAATCCA AACAACCTAT
TCATACTTTT TGTGTGTTGA ACTTCCCTTT GGTCTAGTAA GGGAATAAAG GGCACTAGAT CTTTTTAATG AGAAGGGAAA
GTAGGTCAGG TAGTCAAATA TGAACATAAT ATCTGCTGTT AGACGTCTAT GCAGGGTAGT TGTCTATTGT TATATGCCAC
TATGAAGGTC TTTACAGCTT TATATGGTAT ATACAGACTT AATGCTGCTA TGACTATTAC CTATTGTACG GGGATTTAGT
CTTGGAATTT GATATGTGAA CTCTCACATG ACCTAAGCAA CAAGCTTTGA TATATCATTC AAATCTCTAT GTTGAAACAG
AGAAAGCACC TAATGCAATG TCATCCCCTC AGGGAGGAGA CTGGTCCAAG TTTTTATGTT TTATAGTCTT GGAAAGAGTA
TGGATAATGT TTATGTAGTA GTATGCTTTA GAACCATAGA CATTTTGCCT GTCAACTATT GGATAATGTG ATTTAAACTT
TATTTGCTTT CTGTGTTAGC TTCTTGGTAG TTGGTACTGC TTTGATTCAT CCGTTACTAA AATTGGGTAG TTCCAGGCAT
GCTGCTTTAT TCCTGGCCTT CCATTTCCCT GTTTTTATTT TTGTGCAGTC AAAGCTGTGA CCTGTTTCTT CTATTTGTAT
TTTATTCTGC ATCTGCCATA TTCATGATGA ATTGCTCGAG AAAGTTTTGT TTCATACCAT TTCCAGCATA ATGGACCAAA
TTCGAACAGT GCTCTACATA AAATTCACAT CTAAACCATG TGTTGTAATT GCTTCAAAGA TCCAACTTTT TCTTCACTAT
ACTAATCCAG GGCCAGCATG ATGAAATCGA GTTAAAATTC TTTGAAGAGA GAGCTGCGCT TGAAGCGAAG TACCAGAAGC
TTTATGAACC CTTGTACACA AAGGTATACT TGTTCTTTAT GTTAAATATG TGAACAGTAT TCCTTTTGTT ATTTTCTTTT
GTGACAGTTA CTGAACCCCT GCCCCTTTTC CTGTTTTCCA GAGGTATAAC ATAGTAAATG GAGTTGTTGA GGTTGATGGT
GGAAATGACG AACCAGCCAG TGAAAATGCT GCTGAGGGTA AAGATGCAGA TGGTACCAAA TCAAGTTTAA TTTTATCTGT
TGGTGAATGT TTCACATTCT GATTTATGAT TAAACCATTT TTTTTCAGCT AAAGGAGTCC CAGATTTTTG GCTTACTGCT
ATGAAAACAA ATGAAGTGCT TTCTGAGGAG GTATAGTATG GTTTACTTTT GTGTTGTTTT TTAGGTGCAT TGCAGTAATT
GTTGATTGTG TTATTGCTTT ATTAGATCCA AGAGCGTGAC GAGCCTGCTT TGAAATATCT GAAAGATATC AAGTGGGCTA
GAATTGACGA TCCTAAGGGT TTCAAGCTGG ATTTTTTCTT TGATACGAAC CCTTTCTTCA AGAACTCTGT CCTAACAAAA
ACGTACCACA TGGTTGATGA AGATGAACCA ATTTTGGAGA AAGCAATTGG GTAAGTTGTT TCATCCTCTG TTGAAACCTG
TAACTGCACG TGTTGTTAAA ACTAACCATG TTGGCATGTT ATGTGCACTG CAGGACTGAA ATTGAGTGGT ATCCTGGTAA
AAACCTGACA CAGAAGATTC TAAAAAAGAA ACCCAAGAAA GGTTCAAAGA ATGCAAAGCC TATTACCAAA ACTGAAGTCT
GTGAGAGCTT CTTCAACTTT TTCAGTCCCC CGCAAGTACC CGATGATGAT GAGGACATTG ATGAAGACAC TGTATGTTCT
ATTTTGATAT TTGACATGCA TTTGTTCAAT GATATCATAT TTGGTGTGCT TTGGTAGTAA ACTTGTTCCT TCAATTTATG
ATAGGCTGAT GAGCTTCAGG GTCAAATGGA ACATGATTAT GACATTGGGT AAGTACTAGT CATTGCCTGC CACATACTAA
TGTTCTATCC GTCATGTTGA TAAGCTCTTA TGGCTATTCT GATGATATTT TTGGTCGGAA ATTACTTATA GGACCACCAT
AAGGGATAAG ATCATCCCAC ATGCTGTTTC CTGGTTTACT GGTGAGGCTG TGCAAGCCGA GGATTTTGAC GATATGGAGG
ATGATGAAGA AGATGATGAA GACGATGATG AAGATGAGGA GGAGGAAGAA GAGGATGAGG ATGAAGACGA AGACGATGAG
GAAGAAAAAA GCAAGCCAAA GAAGAAGGTA ACTTCACTAT GTCATAGAAC CTATTTCTGT AGCATCATTC TCCTATTTAG
CCAGTTTCTA ATACATTGCT TTTTTGATTG TCTGGACAGT CGGCAGGCAA ACCGAAGGTA CATGCTTTAC ACCAACCTTA
AACGACTTGA CATCAATTTT CCTTGCTTCG AGTGTTATAA TCTTATAGCT CATAGTACAT TCTCCACCAG CTACCATCGA
AGGGCGGGGC ACAAGGAGGT GCTGATCAAC CAGCAGATTG CAAGCAGCAG TAGAACTGTT GTGGTTCACA GCGCCACGTG
AGCTGTTTGT TATTTTGTTG ATGCAGTATT TTGCGTTGAA CTGCCCAGGA AATTATTGGT TGGTTGTGCA CGGGTGAGGT
TTCGTTGCTG GTATATGTTA CCCGTGGTTT TATTGGCGAA GTTGTGAGGC CTGTCTGGAA CATCTATATT AGAGTATTAT
TATGTTTTAG TTATATGTAA TCGGTTTATT AAGTTTGTGT AATTATCTGG AATCTGCCGG TGGAACTTTT ACTAGTATTC
ATTTGAGCCT TATGGAAAAA AAATGAAATA TGTCTTATGG 

Locus: Os06g0149400

Loading...

Locus: Os06g0149400

Loading...