Os06t0154500-01

Locus

Os06g0154500

Description

Mitogen-activated protein kinase, Brassinosteroid (BR) signaling and homeostasis, Regulation of grain size and plant height

RAP-DB Gene Symbol Synonym(s)

MAPK6, OsMAPK6, OsMPK6, OsSIPK, SIPK, OsMAPK1, MAPK1, MPK1, OsMPK1, MPK6, DSG1

RAP-DB Gene Name Synonym(s)

MITOGEN-ACTIVATED PROTEIN KINASE 6, Mitogen-activated protein kinase 1, MAP kinase 1, MAP kinase 6, dwarf and small grain1

CGSNL Gene Symbol

DSG1

CGSNL Gene Name

DWARF AND SMALL GRAIN 1

Oryzabase Gene Symbol Synonym(s)

OsMAPK6, MAPK6, OsMPK6, OsSIPK, SIPK, OsMAPK1, MAPK1, MPK1, OsMPK1, MPK6, OsDSG1

Oryzabase Gene Name Synonym(s)

Mitogen-activated protein kinase 1, MAP kinase 1, MAP kinase 6, dwarf and small grain1

Transcript Evidence

AB183398 (Kinmaze)

AJ535841

AK111942

Protein Evidence

Q84UI5

Literature

PMID: 26366992

PMID: 15951489

Note

Manual Curation

November 16, 2015

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: MAP kinase activity (GO:0004707)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Protein kinase, ATP binding site (IPR017441)

Mitogen-activated protein (MAP) kinase, conserved site (IPR003527)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

001-021-F11 (Online Clone Ordering)

J023007A05 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0154500-01)

RiceXPro (AK111942)

Others

Oryzabase (6221)

KEGG (Os06t0154500-01 (EC:2.7.11.24))

Transcript

1615 bp

>Os06t0154500-01 Mitogen-activated protein kinase, Brassinosteroid (BR) signaling and homeostasis, Regulation of grain size and plant height
GACGAATTCCGCCTCCACTTTCCCTTCCCTTCCTCCTCCACCTCCACCTCCTCGTCGCGA
TCCAAATCCGAATCCGGCCATGGACGCCGGGGCGCAGCCGCCGGACACGGAGATGGCGGA
GGCCGGCGGCGGGCAGCAGCCGCCTGCTGCGGCTGCGGCGGCGGGGGCGGGGGCAGGGGC
GGGGATGATGGAGAACATCCAGGCGACGCTGAGCCATGGCGGGAGGTTCATCCAGTACAA
CATCTTCGGGAACGTGTTCGAGGTCACCGCCAAGTACAAGCCCCCCATCCTCCCCATCGG
CAAGGGCGCCTACGGCATCGTCTGCTCGGCGCTCAACTCGGAGACGGGGGAGCAGGTGGC
GATCAAGAAGATCGCCAACGCGTTCGACAACAAGATCGACGCCAAGCGCACGCTCAGGGA
GATCAAGCTGCTCCGCCACATGGACCACGAGAATATTGTTGCCATAAGGGATATCATACC
TCCTCCACAAAGGAATTCATTCAATGACGTTTATATTGCATATGAATTGATGGATACTGA
TCTGCATCAAATTATTCGCTCAAATCAAGCATTGTCAGAGGAGCACTGCCAGTATTTCCT
TTATCAGATTCTCCGTGGCTTGAAGTATATACATTCAGCAAATGTCCTTCACCGAGACTT
GAAGCCCAGCAACCTACTTTTGAATGCAAATTGTGACCTCAAAATTTGTGATTTTGGACT
TGCTCGTACCACCTCAGAAACCGATTTTATGACTGAGTATGTTGTCACAAGATGGTATAG
GGCACCGGAACTTCTGTTGAATTCCTCTGAATATACTGCAGCAATTGATGTGTGGTCTGT
GGGCTGTATTTTTATGGAACTCATGGATCGTAAACCTTTGTTTCCTGGAAGAGATCATGT
CCATCAATTACGTCTACTAATGGAGCTCATCGGAACGCCAAATGAGGCTGATCTGGATTT
TGTAAATGAAAATGCAAGAAGATACATTCGCCAACTTCCTAGACATGCAAGGCAGTCCTT
TCCTGAAAAATTTCCACATGTTCATCCTTTAGCAATTGATCTGGTTGAAAAGATGCTGAC
ATTTGATCCTAGACAGAGAATAACAGTTGAAGGTGCCCTTGCACATCCTTACCTGGCATC
ACTGCATGACATAAGTGATGAGCCAGTCTGCTCATCACCCTTCAGCTTTGACTTCGAGCA
GCATGCATTGTCCGAGGAACAAATGAAGGATCTAATCTACCAAGAAGGCCTTGCGTTCAA
CCCTGATTACCAGTAGCTGGTGTTCTATTTCAGCCTTGGATTGATTCTATTCATATGGAG
TTTTTTCCTCCTGCGCCACAAAAGGTCGCCGACAGTGATCACTAGTTGTAAATAATTGCC
TCACCTGAAAAATCCTCCCTGGTTCAAAGCTGAAGGTGTTGTTCTAAGAGTAGAAATGTA
CTTTGTGATCAAGTTCCTGGGTAGCTGCTATGCCATTCTTATGCTTATGTATGTTGTTTA
ATGTGGGATTTTTTTCCATCTTAAATGTTTTTAGTCCCTTTTGTAAGAAGAGTTAGTTCA
TGAACGATGACGGCCTAAATTCTGCGGTTATCATCAAATTCCCCATTTTCTTGTC

CDS

1197 bp

>Os06t0154500-01 Mitogen-activated protein kinase, Brassinosteroid (BR) signaling and homeostasis, Regulation of grain size and plant height
ATGGACGCCGGGGCGCAGCCGCCGGACACGGAGATGGCGGAGGCCGGCGGCGGGCAGCAG
CCGCCTGCTGCGGCTGCGGCGGCGGGGGCGGGGGCAGGGGCGGGGATGATGGAGAACATC
CAGGCGACGCTGAGCCATGGCGGGAGGTTCATCCAGTACAACATCTTCGGGAACGTGTTC
GAGGTCACCGCCAAGTACAAGCCCCCCATCCTCCCCATCGGCAAGGGCGCCTACGGCATC
GTCTGCTCGGCGCTCAACTCGGAGACGGGGGAGCAGGTGGCGATCAAGAAGATCGCCAAC
GCGTTCGACAACAAGATCGACGCCAAGCGCACGCTCAGGGAGATCAAGCTGCTCCGCCAC
ATGGACCACGAGAATATTGTTGCCATAAGGGATATCATACCTCCTCCACAAAGGAATTCA
TTCAATGACGTTTATATTGCATATGAATTGATGGATACTGATCTGCATCAAATTATTCGC
TCAAATCAAGCATTGTCAGAGGAGCACTGCCAGTATTTCCTTTATCAGATTCTCCGTGGC
TTGAAGTATATACATTCAGCAAATGTCCTTCACCGAGACTTGAAGCCCAGCAACCTACTT
TTGAATGCAAATTGTGACCTCAAAATTTGTGATTTTGGACTTGCTCGTACCACCTCAGAA
ACCGATTTTATGACTGAGTATGTTGTCACAAGATGGTATAGGGCACCGGAACTTCTGTTG
AATTCCTCTGAATATACTGCAGCAATTGATGTGTGGTCTGTGGGCTGTATTTTTATGGAA
CTCATGGATCGTAAACCTTTGTTTCCTGGAAGAGATCATGTCCATCAATTACGTCTACTA
ATGGAGCTCATCGGAACGCCAAATGAGGCTGATCTGGATTTTGTAAATGAAAATGCAAGA
AGATACATTCGCCAACTTCCTAGACATGCAAGGCAGTCCTTTCCTGAAAAATTTCCACAT
GTTCATCCTTTAGCAATTGATCTGGTTGAAAAGATGCTGACATTTGATCCTAGACAGAGA
ATAACAGTTGAAGGTGCCCTTGCACATCCTTACCTGGCATCACTGCATGACATAAGTGAT
GAGCCAGTCTGCTCATCACCCTTCAGCTTTGACTTCGAGCAGCATGCATTGTCCGAGGAA
CAAATGAAGGATCTAATCTACCAAGAAGGCCTTGCGTTCAACCCTGATTACCAGTAG

Protein

399 aa

>Os06t0154500-01 Mitogen-activated protein kinase, Brassinosteroid (BR) signaling and homeostasis, Regulation of grain size and plant height
MDAGAQPPDTEMAEAGGGQQPPAAAAAAGAGAGAGMMENIQATLSHGGRFIQYNIFGNVF
EVTAKYKPPILPIGKGAYGIVCSALNSETGEQVAIKKIANAFDNKIDAKRTLREIKLLRH
MDHENIVAIRDIIPPPQRNSFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRG
LKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLL
NSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVNENAR
RYIRQLPRHARQSFPEKFPHVHPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLHDISD
EPVCSSPFSFDFEQHALSEEQMKDLIYQEGLAFNPDYQ*

5'UTR

chr06:2812851..2812929 (- strand) : 79 bp

CDS

chr06:2812606..2812850 (- strand) : 245 bp

chr06:2812389..2812518 (- strand) : 130 bp

chr06:2809694..2809831 (- strand) : 138 bp

chr06:2808302..2808634 (- strand) : 333 bp

chr06:2807790..2807970 (- strand) : 181 bp

chr06:2807007..2807176 (- strand) : 170 bp

3'UTR

chr06:2806668..2807006 (- strand) : 339 bp

FASTA

>Os06t0154500-01 class=Sequence position=chr06:2806668..2812929 (- strand)
GACGAATTCC GCCTCCACTT TCCCTTCCCT TCCTCCTCCA CCTCCACCTC CTCGTCGCGA TCCAAATCCG AATCCGGCCA
TGGACGCCGG GGCGCAGCCG CCGGACACGG AGATGGCGGA GGCCGGCGGC GGGCAGCAGC CGCCTGCTGC GGCTGCGGCG
GCGGGGGCGG GGGCAGGGGC GGGGATGATG GAGAACATCC AGGCGACGCT GAGCCATGGC GGGAGGTTCA TCCAGTACAA
CATCTTCGGG AACGTGTTCG AGGTCACCGC CAAGTACAAG CCCCCCATCC TCCCCATCGG CAAGGGCGCC TACGGCATCG
TCTGGTTCGT TTGCTCCCCC CTCTCTCCCA TTCCGTTGGC GGCGGCGGCC TGATTTTGGT TTGGATTTTG GATTTTGGGT
TTGGATGACA GCTCGGCGCT CAACTCGGAG ACGGGGGAGC AGGTGGCGAT CAAGAAGATC GCCAACGCGT TCGACAACAA
GATCGACGCC AAGCGCACGC TCAGGGAGAT CAAGCTGCTC CGCCACATGG ACCACGAGAA TGTCAGTGCT CCCGATCCGC
TCCATTGTTT CGACCACGGA ATTCCCTTCC CCCCCACCCA CCCTCGATTT TTAGGCGCAG ATTTTGAGAT TCTCGTTGAA
TGCTCTTGTC TCTGGTTAGT TAAGTTGGTT GCATTAAATG GGGAAAGGAG GAGGAGGTGA GGGTTAGGTT ACCAAATGAT
TGAGTTCGTC ACTGCTCGGC CTAATTTGGT AGAGCTTTTC CCTCCATTCT TGCTGCTGAT GATGAGTGCT GCGAGCTTCA
GAAATAGAGG TAACTTTGGA GATGCCTTTA AAGAAGCCAT CTGCCTTTTG GGGATGTTGT TATTCATTGT GTTCTTGAAT
AGTGGGGGAG CGAGTGATGT GAACAGACCT GACCTGGAGA GTAGCAACAT CACATGATTC TCGTACGTGC TGATGTCACA
AGCCACAACT AGCTTGAGGA GGAGGAGGAG GAGGAGGAGG AGGAGGAGGA CCAATCTGGT GTTACACCTT TTTCCTAAGT
CAGTCAAATC CAGTCTGAAT GCAGTGGGAG TGACTGCCAG TGGGGAGGGA ATTAGGGGAT AGGAGTACTA GGAATTGTGT
TATTGTTGGA AAGTTTTGAG ATTGACTTTG TGTGTGCATG TTGGACTTGG ACCTTTGAAA TTTACCAATT TAAAGACTGA
CTAATAGGAG TAGCCCACTG TTGTATTTCC TGCGTAGGCC TGAAGTATCA TTTTCAGCTT ACCAGAGGCA ACATATTTTT
TCTATGGTTA GTGGTAGAAA GACAGCCACA GGGGAAGTGA ATTAGAGAAT AGGCCATATC TTCATAGCCA GCCCTAGAAA
AACTCAGCTT CTTCTGAAGA GGTGAATTAA ATTTGGATGG TCATAAATAT TCCGTTATAA TTAAACTAGT GGATTTTCCC
ATGCAAATAT GAGAGGAGCT AGATTTAAAA TTAGAGTTAT ATTTTGTATA GAATTTACTG GTCAACCTGG ACCGTTGTAA
TCTAGACCCA CCACTATAAT AAACGGGCAT ATATTTATCT TTTTTCCCCG ATTAATGTCG TTATTCTAGG CTTCTAGATT
GAACGTGGTG GCACCCTTTT GCACCCTCTT TATTATAACA TAATAGATCA ATTGATACTT CCCTAAAAAA GGTTCATACA
AAAAGTTGCT CAGATACTGC TTTTGCTGAA CCATAGACTG GTTGACACAG GCATACACAA ATGCATGCTC ATGCCTTTTT
TTGGAAGTTT TTTCAAACTA AAACTGATCC ATTTTGTTTG TATCCTACTG CAGAAAGAGA AGTGTTTAAT TTCAGGTTTT
AGTGCTCCAA TTATGCAGGG GAGGCTTTTG GGAGTTATAC CAGTTACGGG TGTTTGTAGA AAACGATCGG ATTAGGCAAA
TTTTGGAGTA GAAGTCCTTA GATAATGCAC CTGCTTTATT GCCATCAGCT AAGATTGTGT ATCAAGTCAA ATTCTACTTT
TCAAATCTGG CTATAAATTC AATTGTATGT ACGGAAAGTT GGAAACATGA GCTAAGATTT GTACATCAAG TCCAATTCTA
CTTTTAAAAT ATAGCTTGCA CAAAAAATGG CTATTTTGCA TTATTACATA AAACATTACT TCCAAATTGG CGATCCTGTA
TTCTGAAAGA TGTATTGGAA CTTTTTTTTT GTCATGTGCA CGTGCTGCAG GTTGGCTGCA GACAGAAGGC AGCAGCCCGA
GTAGCGATTT CTGGCTGCAG TATATTACTT CAATACCAAG TTATCATTTA ATTATGAAGT GCACTAAGCT GTTGCTTTCT
ATGTACATGT AAGCTTATCT ATGAGATAAA AAAACAAACA AACAAAAAAA GCCCGTGGTT AGGATGGCTT GCGGCATTCA
GCTAAGTCGA GAAAAATGCC CCTGAACGTG GCACGTCACT GGGCATGCTT AACCTCACGC GGGGAGCACT CTTCTACCAG
CATTAACGAG GGGGGATTTT TTTTGTGCAA AACCTGGGCT TGAGCCTTGG TCGGTGTCCC CTCTACCAGA GACTCTACCA
CTGTGCTACA CACACGTTTG TTCAGCTTAT CTATGAGATA AATTATTAGA ATCCTCTACA TAAGTTATTA GAATTATGCA
AAGTCTCCTC CATTGCTTCC TTCTATTGAT CTATTATATG TCCATCTTCG TCTAAAGCCC TTTACTAGTC ACTATTCAAG
TCATCATTAG CTTGCTGTTC ATCCCCATTA CACACTCTAA TTTTCATTTT AAGGGAAATG CATGTTGGTC TGCCTCCTTA
AAAAACCACC ATGTTTGAGC GTTTAAATGG CAAAAACACT TGAGCTATAA CATTAAGCCA TCATGAATAA GATAGATCTC
TTTGTCAAGT CATTTTCATA TGGTATTTCC TGGTCCATGC AATATGTTTG TTCTTGCTTT GGTTGGTCTG GACATAGTTG
ATTTACTTAT TTTATCTACT CCTATAAGAT ATTTGGAGCT GGTCTGTTGT ATTTCACATA TCCAGCAAGC TCTTGTGTTT
GCACATCGAT GCTCCAAAAG GCAATAACTT GTCTCAACTT CCTACTTATG TGATGCAGAT TGTTGCCATA AGGGATATCA
TACCTCCTCC ACAAAGGAAT TCATTCAATG ACGTTTATAT TGCATATGAA TTGATGGATA CTGATCTGCA TCAAATTATT
CGCTCAAATC AAGCATTGTC AGAGGAGCAC TGCCAGGTAC CTTCTTCAAA AGAAAAACAC AACTTTATTT CCACTTTAGC
ATTTATTTCA TACAAATGGC TTTTCTGGTC TGCTTGGATT CTCTTGCTTG TCTAGGCCTC TGCTCAAATT GAGTTTTCAA
GACCTAAAAA GTGGGAAGTA TTGAAGTATG TATTGATGGT TTATAAATGT TTTGTGTAAG AACTATAAGG AATTTGGTAC
AAAAGGTTGA ATGTAAAGCT TTTATGGTAA TTTTGTATCA CATTTTAAGA ATTCTGCAGG TATGCATAAT CTTTGAAATT
AAGAAACGAA TTTAGCGACC TACTAATATA CCTGAACGTA CCTTTGCCCT GCAAAGCATA TATGCAAAGT GCTACAATTA
GGTTATCTCA GTGCACCATT GATCATTGGA TCAAACTAAC GTTTTCTTTG GAGATACCAT ATTATTTGCT AACCGATATA
AAATCGAATA ATGAGTTGAT TGCTATTTAT CAGTAGACCA CATACTGTTA GGAGCTGGCG GCAAGGCACC GCAGCTCCGA
AGGTTGTAGC AGTGCTTGAC GGGAGGGTGA TGCCGATGCC CTCGCCTCCC ACAAAGCCAT GGTGAGGAGA AACAGAGAAA
AGAGTGGCCT TATATAGGCG ATTACAATCT GCTAATGAAT CAGAACTAAC TGAAACAAAC CTCAAATCTT AAGGGATAAC
TCTTATCTAA TGCAAGCAAC AGATAACGGC GAGAACGACA CTGTGGCGTG CCATGCACGC TCACCGAACT CGTGTTCTTG
AGACATTCAA AGGATTCCCC ACATAACACA TTCAACGTGA GAAGGGTTCA ATGCCCAATC ACACTGGAGA GGTCTTGCTG
TATTGCAGCT TGCAAGCTCT TATGATCAAT GCTACAGATA GATCTCTCCC TTTCTTGAGT GGAACTCTAG AATGGCTGCC
TCACCTATCT TTCCTTATCC AGATAACTTG ATTGTGTTCT CTTGTATTTT CCTTGTGCAT GCATCTACCA TGTTCTGAGA
AATAATACAT GTTTGGTATA ACTGTTCTTG CGTAATTCTT TACCTTTTTG TGCAGTATTT CCTTTATCAG ATTCTCCGTG
GCTTGAAGTA TATACATTCA GCAAATGTCC TTCACCGAGA CTTGAAGCCC AGCAACCTAC TTTTGAATGC AAATTGTGAC
CTCAAAATTT GTGATTTTGG ACTTGCTCGT ACCACCTCAG AAACCGATTT TATGACTGAG TATGTTGTCA CAAGATGGTA
TAGGGCACCG GAACTTCTGT TGAATTCCTC TGAATATACT GCAGCAATTG ATGTGTGGTC TGTGGGCTGT ATTTTTATGG
AACTCATGGA TCGTAAACCT TTGTTTCCTG GAAGAGATCA TGTCCATCAA TTACGTCTAC TAATGGAGGT TAGAACACAC
TCTTATCTTT TGAACTTTAT TTTATATTGA ATTGATCAGG TTATGTTGTG TGGTCATATA TTTAGCATAA CTGGAGTACT
GTTTTGGAAA TATATAATAT GTTGATTATC CTATGGGAAT ATGTTAAAAC TAAGGAAAAT GCAAAGAGGA GAGAATTTAT
GTTGCTCCAG AAGGTCCTGG CTTTCTGGCT GATATGCAGG ATACTGAATT CTGAGTCATG GCTATTAATA CAAACGCATT
TCTCACTAGA GGATTTATAT ACTATCTGTT TCACATTATT GTGTGTTTGA TTTTCCTATC ATAAATTTCT TAATTGCAGC
TCATCGGAAC GCCAAATGAG GCTGATCTGG ATTTTGTAAA TGAAAATGCA AGAAGATACA TTCGCCAACT TCCTAGACAT
GCAAGGCAGT CCTTTCCTGA AAAATTTCCA CATGTTCATC CTTTAGCAAT TGATCTGGTT GAAAAGATGC TGACATTTGA
TCCTAGACAG AGAATAACAG GTCAGTATTG GCATAGTATG TTTTAGTGAT TTAAAGGGCA TTTGAATGTT GTTTTTGCCA
TCTTATCTAT CTTGCCAATA GCAAGTAAAA AATAGGCCTT TCTCCTAAAG AAAGAAAAGA GTGAAAGAAG CCTTTGAAAG
CCCTCATAAA CTATGGTTTT TTTTAACACC ATGTCTACCT TTCTTTTAAT CTGCCACTGG CCATTTCTAG TTAGCGTTTA
CCACTTCCTA TCTGTTTTAA GATAGAAAGT AACAACTGCA GTGGATACTT AAATATATTT GTAGAGCATC TGTGCATGAC
TTCTATATTA CTAAATCACA TGCAAACCTA AATATTTTTT TTAAAAAAAA AAACTATGTC GATCCTTTTT ACCTCTTGAT
CCACCCTAAC CTAATCCAGG TGGTATAGGT GTGTCATCAC TTTATTCTTA ATGCGTGAAT TGAGCATCAT TCTTAACTCA
TAGGTGGGAA TGTTGAAAGA GTCATTGCCT TGTGGTGTTT TCTAATGTTG AAAATGCATT GTTCCCTGTG TCAAAACTTT
TGACCTGATT TTCTCTGCAT GTTTCATATT ACTGAATGCC CCCTTATCTT TTCTCCTATT TCTTCTTATC CAGTTGAAGG
TGCCCTTGCA CATCCTTACC TGGCATCACT GCATGACATA AGTGATGAGC CAGTCTGCTC ATCACCCTTC AGCTTTGACT
TCGAGCAGCA TGCATTGTCC GAGGAACAAA TGAAGGATCT AATCTACCAA GAAGGCCTTG CGTTCAACCC TGATTACCAG
TAGCTGGTGT TCTATTTCAG CCTTGGATTG ATTCTATTCA TATGGAGTTT TTTCCTCCTG CGCCACAAAA GGTCGCCGAC
AGTGATCACT AGTTGTAAAT AATTGCCTCA CCTGAAAAAT CCTCCCTGGT TCAAAGCTGA AGGTGTTGTT CTAAGAGTAG
AAATGTACTT TGTGATCAAG TTCCTGGGTA GCTGCTATGC CATTCTTATG CTTATGTATG TTGTTTAATG TGGGATTTTT
TTCCATCTTA AATGTTTTTA GTCCCTTTTG TAAGAAGAGT TAGTTCATGA ACGATGACGG CCTAAATTCT GCGGTTATCA
TCAAATTCCC CATTTTCTTG TC