Os06t0157500-01

Locus

Os06g0157500

Description

Florigen, Flowering time, Long-day promotion

RAP-DB Gene Symbol Synonym(s)

RFT1, FT-L 3, OsFTL3, FT-L3, RFT

RAP-DB Gene Name Synonym(s)

RICE FLOWERING-LOCUS T 1, Rice Flowering-locus T 1, RICE FLOWERING LOCUS T 1, FT-like gene 3

CGSNL Gene Symbol

RFT1

CGSNL Gene Name

RICE FLOWERING-LOCUS T 1

Oryzabase Gene Symbol Synonym(s)

FT-L 3, OsFTL3, FT-L3, RFT, OsRFT1

Oryzabase Gene Name Synonym(s)

Rice Flowering-locus T 1, RICE FLOWERING LOCUS T 1, FT-like gene 3, RFT

Transcript Evidence

AB062676

Protein Evidence

Q8VWH2

Literature

PMID: 24098411

PMID: 12407188

Note

Manual Curation

October 1, 2014

Functional domain (InterPro)

Phosphatidylethanolamine-binding protein PEBP (IPR008914)

Phosphatidylethanolamine-binding, conserved site (IPR001858)

Expression Databases

TENOR (Os06t0157500-00)

Others

Oryzabase (9620)

Transcript

866 bp

>Os06t0157500-01 Florigen, Flowering time, Long-day promotion
CCTGTCACTGTTTGGCTAGCTTAACCTTCCTGACATCTATCCTCTGGATTGAACGGCAGG
AGATACCTAAGCTAGCTAGCaatctctatcgatctgtttgtttacatgttcagttaaagg
ttactgagaaatgcctagagtttttccggctagcttcataagttagtgggttagctgacc
tagattcaaagtctaatccttttatttatttgatattagatatcctaacgtttttagtta
gagGTTATTAATTTGACATGGCCGGCAGCGGCAGGGACGATCCTCTTGTGGTTGGCAGGA
TTGTGGGTGATGTGCTGGATCCATTCGTCCGGATCACTAACCTCAGTGTCAGCTATGGTG
CAAGGATCGTCTCCAATGGCTGCGAGCTCAAGCCGTCCATGGTGACCCAACAGCCCAGGG
TCGTGGTCGGTGGCAATGACATGAGGACGTTCTACACACTCGTGATGGTAGACCCGGATG
CTCCGAGCCCAAGCAACCCTAACCTTAGGGAGTATCTACACTGGCTGGTCACCGATATTC
CTGGTACCACTGGAGCAACATTTGGGCAAGAGGTGATGTGCTACGAGAGCCCAAGGCCAA
CCATGGGGATCCACCGGCTGGTGTTCGTGCTGTTCCAGCAGCTGGGGCGTCAGACGGTGT
ACGCACCGGGGTGGCGCCAGAACTTCAGCACCAGGAACTTCGCCGAGCTCTACAACCTCG
GCTCGCCGGTCGCCACCGTCTACTTCAACTGCCAGCGCGAGGCCGGCTCCGGCGGCAGGA
GGGTCTACCCCTAGCTAGCTACGCATGCCACCCGGCCTCCATGCATGCAGCAGCTATAGC
TAAGCTGAGACCTGCCTAGCTGTATA

CDS

537 bp

>Os06t0157500-01 Florigen, Flowering time, Long-day promotion
ATGGCCGGCAGCGGCAGGGACGATCCTCTTGTGGTTGGCAGGATTGTGGGTGATGTGCTG
GATCCATTCGTCCGGATCACTAACCTCAGTGTCAGCTATGGTGCAAGGATCGTCTCCAAT
GGCTGCGAGCTCAAGCCGTCCATGGTGACCCAACAGCCCAGGGTCGTGGTCGGTGGCAAT
GACATGAGGACGTTCTACACACTCGTGATGGTAGACCCGGATGCTCCGAGCCCAAGCAAC
CCTAACCTTAGGGAGTATCTACACTGGCTGGTCACCGATATTCCTGGTACCACTGGAGCA
ACATTTGGGCAAGAGGTGATGTGCTACGAGAGCCCAAGGCCAACCATGGGGATCCACCGG
CTGGTGTTCGTGCTGTTCCAGCAGCTGGGGCGTCAGACGGTGTACGCACCGGGGTGGCGC
CAGAACTTCAGCACCAGGAACTTCGCCGAGCTCTACAACCTCGGCTCGCCGGTCGCCACC
GTCTACTTCAACTGCCAGCGCGAGGCCGGCTCCGGCGGCAGGAGGGTCTACCCCTAG

Protein

179 aa

>Os06t0157500-01 Florigen, Flowering time, Long-day promotion
MAGSGRDDPLVVGRIVGDVLDPFVRITNLSVSYGARIVSNGCELKPSMVTQQPRVVVGGN
DMRTFYTLVMVDPDAPSPSNPNLREYLHWLVTDIPGTTGATFGQEVMCYESPRPTMGIHR
LVFVLFQQLGRQTVYAPGWRQNFSTRNFAELYNLGSPVATVYFNCQREAGSGGRRVYP*

5'UTR

chr06:2926823..2927079 (+ strand) : 257 bp

CDS

chr06:2927080..2927283 (+ strand) : 204 bp

chr06:2927431..2927492 (+ strand) : 62 bp

chr06:2927606..2927646 (+ strand) : 41 bp

chr06:2928173..2928402 (+ strand) : 230 bp

3'UTR

chr06:2928403..2928474 (+ strand) : 72 bp

FASTA

>Os06t0157500-01 class=Sequence position=chr06:2926823..2928474 (+ strand)
CCTGTCACTG TTTGGCTAGC TTAACCTTCC TGACATCTAT CCTCTGGATT GAACGGCAGG AGATACCTAA GCTAGCTAGC
aatctctatc gatctgtttg tttacatgtt cagttaaagg ttactgagaa atgcctagag tttttccggc tagcttcata
agttagtggg ttagctgacc tagattcaaa gtctaatcct tttatttatt tgatattaga tatcctaacg tttttagtta
gagGTTATTA ATTTGACATG GCCGGCAGCG GCAGGGACGA TCCTCTTGTG GTTGGCAGGA TTGTGGGTGA TGTGCTGGAT
CCATTCGTCC GGATCACTAA CCTCAGTGTC AGCTATGGTG CAAGGATCGT CTCCAATGGC TGCGAGCTCA AGCCGTCCAT
GGTGACCCAA CAGCCCAGGG TCGTGGTCGG TGGCAATGAC ATGAGGACGT TCTACACACT CGTACGGATC ATATCTTGGA
TGCAGAGACC CACCAGAAGT TATTTAATTA CTTTCATTAA TTATCATAAA ACTAGACTAT AAATTATATT TTTTACATGG
ATGCATGTTA ATTTTGTGTG GCTTACGTAC TAATCTAATT ACCTACAGGT GATGGTAGAC CCGGATGCTC CGAGCCCAAG
CAACCCTAAC CTTAGGGAGT ATCTACACTG GTAGGCACCG ATCAGATATG TTAGCTAGCT AATTGTATAC ATTCGTCCTA
GAATATAAAG AATTTGGACC GGATTCTCAA TCATTCGCGT TGATTCTCTT TGTCTGTCTG TAGGCTGGTC ACCGATATTC
CTGGTACCAC TGGAGCAACA TTTGGTCAGT AAACTAGTAT ATATATATAG TACTCATATC AATTTCGATG TAACAGCAAC
ATATGTGGCA GTTCCATGAA TTTTTATTAC CTTGGTCCTA CCCCATATAT ATACTTCAAA AATTGCATAA TGACAAAATT
Atactccctc cgtattttaa tgtatgacgc cgttgacttt ttaaccaaca tttgaccatt cgtcttattt aaatttttta
tgcaaataca aaaatactta tgtcatgctt aaagaacatt tgatgataaa tcaagtcaca ataaaataaa tgataattac
ataatttttt tgaataagac aaaaagtcaa acgtttgtta aaaagtcaat gtcgtcatac attaaaatac ggagggagta
TCTATTTTGT CAAAAATTTT CGTCAGATTT GAAGGATAGG GCTGTACTTC TTCTATGCCA AAATGGAGGG TGGTGATCCC
CTCAAAACTT GTAGAACAGC CACTGTTGAT ATATATATGG TGAATAACGT AGATAATTAA ATTGATGCAG GGCAAGAGGT
GATGTGCTAC GAGAGCCCAA GGCCAACCAT GGGGATCCAC CGGCTGGTGT TCGTGCTGTT CCAGCAGCTG GGGCGTCAGA
CGGTGTACGC ACCGGGGTGG CGCCAGAACT TCAGCACCAG GAACTTCGCC GAGCTCTACA ACCTCGGCTC GCCGGTCGCC
ACCGTCTACT TCAACTGCCA GCGCGAGGCC GGCTCCGGCG GCAGGAGGGT CTACCCCTAG CTAGCTACGC ATGCCACCCG
GCCTCCATGC ATGCAGCAGC TATAGCTAAG CTGAGACCTG CCTAGCTGTA TA