Os06t0157700-01

Locus

Os06g0157700

Description

Florigen, Heading date

RAP-DB Gene Symbol Synonym(s)

HD3A, Hd3a, FT, qHD3(t)*, FT-L 2, OsFTL2, FT-L2, FTL2

RAP-DB Gene Name Synonym(s)

HEADING DATE 3A, heading date 3A, Heading date-3a, Heading date (QTL)-3(t), Flowering locus T, FT-like gene 2

CGSNL Gene Symbol

HD3A

CGSNL Gene Name

HEADING DATE 3A

Oryzabase Gene Symbol Synonym(s)

Hd3a, FT, qHD3(t)*, FT-L 2, OsFTL2, FT-L2, FTL2, OsHd3a

Oryzabase Gene Name Synonym(s)

heading date 3A, Heading date-3a, Heading date (QTL)-3(t), Flowering locus T, FT-like gene 2

Transcript Evidence

AB052943 (Genbank)

AB052944 (Genbank)

Protein Evidence

Q93WM7 (UniProt)

Q93WI9 (UniProt)

Literature

PMID: 12407188

PMID: 17446351

PMID: 20543848

Note

Manual Curation

May 8, 2009

Functional domain (InterPro)

Phosphatidylethanolamine-binding, conserved site (IPR001858)

Phosphatidylethanolamine-binding protein PEBP (IPR008914)

Expression Databases

TENOR (Os06t0157700-00)

Others

Oryzabase (7216)

Transcript

847 bp

>Os06t0157700-01 Florigen, Heading date
TGCACCACACACAGTTCAGCTAGCAGATCACCTAGCTAGATAGCTGCCTCTATCACAGTA
TATTTGCTCCCTGCAACTTGCTGCTGCTGCAATAGCTAGCAGCTGCAGCTAGTAAGCAAA
ACTATAAACCTTCAGGGTTTTTTGCAAGATCGATGGCCGGAAGTGGCAGGGACAGGGACC
CTCTTGTGGTTGGTAGGGTTGTGGGTGATGTGCTGGACGCGTTCGTCCGGAGCACCAACC
TCAAGGTCACCTATGGCTCCAAGACCGTGTCCAATGGCTGCGAGCTCAAGCCGTCCATGG
TCACCCACCAGCCTAGGGTCGAGGTCGGCGGCAATGACATGAGGACATTCTACACCCTTG
TGATGGTAGACCCAGATGCACCAAGCCCAAGTGACCCTAACCTTAGGGAGTATCTACATT
GGTTGGTCACTGATATTCCTGGTACTACTGCAGCGTCATTTGGGCAAGAGGTGATGTGCT
ACGAGAGCCCAAGGCCAACCATGGGGATCCACCGGCTGGTGTTCGTGCTGTTCCAGCAGC
TGGGGCGTCAGACAGTGTACGCGCCCGGGTGGCGTCAGAACTTCAACACCAAGGACTTCG
CCGAGCTCTACAACCTCGGCTCGCCGGTCGCCGCCGTCTACTTCAACTGCCAGCGCGAGG
CAGGCTCCGGCGGCAGGAGGGTCTACCCCTAGCTAACGATGATCCCGATCGATCTGCTGC
ATGCTCACTATCATCATCCAGCATGCTATACATTGCAGGTTCAGACAATTGAAATGATTC
TCGACACACAACATATATATGATGGTGTAATTAATTATGCAATTAAATAGCTGAGCAAGG
CTAAGGT

CDS

540 bp

>Os06t0157700-01 Florigen, Heading date
ATGGCCGGAAGTGGCAGGGACAGGGACCCTCTTGTGGTTGGTAGGGTTGTGGGTGATGTG
CTGGACGCGTTCGTCCGGAGCACCAACCTCAAGGTCACCTATGGCTCCAAGACCGTGTCC
AATGGCTGCGAGCTCAAGCCGTCCATGGTCACCCACCAGCCTAGGGTCGAGGTCGGCGGC
AATGACATGAGGACATTCTACACCCTTGTGATGGTAGACCCAGATGCACCAAGCCCAAGT
GACCCTAACCTTAGGGAGTATCTACATTGGTTGGTCACTGATATTCCTGGTACTACTGCA
GCGTCATTTGGGCAAGAGGTGATGTGCTACGAGAGCCCAAGGCCAACCATGGGGATCCAC
CGGCTGGTGTTCGTGCTGTTCCAGCAGCTGGGGCGTCAGACAGTGTACGCGCCCGGGTGG
CGTCAGAACTTCAACACCAAGGACTTCGCCGAGCTCTACAACCTCGGCTCGCCGGTCGCC
GCCGTCTACTTCAACTGCCAGCGCGAGGCAGGCTCCGGCGGCAGGAGGGTCTACCCCTAG

Protein

180 aa

>Os06t0157700-01 Florigen, Heading date
MAGSGRDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCELKPSMVTHQPRVEVGG
NDMRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTAASFGQEVMCYESPRPTMGIH
RLVFVLFQQLGRQTVYAPGWRQNFNTKDFAELYNLGSPVAAVYFNCQREAGSGGRRVYP*

5'UTR

chr06:2940004..2940155 (+ strand) : 152 bp

CDS

chr06:2940156..2940362 (+ strand) : 207 bp

chr06:2940525..2940586 (+ strand) : 62 bp

chr06:2940720..2940760 (+ strand) : 41 bp

chr06:2942068..2942297 (+ strand) : 230 bp

3'UTR

chr06:2942298..2942452 (+ strand) : 155 bp

FASTA

>Os06t0157700-01 class=Sequence position=chr06:2940004..2942452 (+ strand)
TGCACCACAC ACAGTTCAGC TAGCAGATCA CCTAGCTAGA TAGCTGCCTC TATCACAGTA TATTTGCTCC CTGCAACTTG
CTGCTGCTGC AATAGCTAGC AGCTGCAGCT AGTAAGCAAA ACTATAAACC TTCAGGGTTT TTTGCAAGAT CGATGGCCGG
AAGTGGCAGG GACAGGGACC CTCTTGTGGT TGGTAGGGTT GTGGGTGATG TGCTGGACGC GTTCGTCCGG AGCACCAACC
TCAAGGTCAC CTATGGCTCC AAGACCGTGT CCAATGGCTG CGAGCTCAAG CCGTCCATGG TCACCCACCA GCCTAGGGTC
GAGGTCGGCG GCAATGACAT GAGGACATTC TACACCCTTG TATGTGAGCT CTACCATGTG TCGTAGTTGG TGCAGAGACC
AGAAGTTATA CTTTCTTTCA TTATTATATT ATAGAAAAAT TTGTTTGGTA CTTAACCCAA GATGACTTTA AAATGCATTA
ATTTGATGTT TGTCATGGTT TTTTGTGGTG TGTACCTGAA GGTGATGGTA GACCCAGATG CACCAAGCCC AAGTGACCCT
AACCTTAGGG AGTATCTACA TTGGTAAGCA CACTAATGTT AAGCTAGCGC ACTTGTTTTC ATGCAATGAT CAAAATAATC
ACTGCTAGCT GATTTACATA CATAACCACA TCTTGACTGC ATGATGGGTT GATCATCTTA ATTTGTTTGT CCACAGGTTG
GTCACTGATA TTCCTGGTAC TACTGCAGCG TCATTTGGTC AGTATTAAAC GATCAAATGG TTTAGATTGA TTTGATTTCC
CACTTAAATA CATTGCAGTA TAAAACTAAC AGAGGTAAAT TGTCTTTCCA TACTATTGTT TGGGGGGGGG GGGGCAGGGG
GCAGTGAGTT GTTGAGCATT TTCCCTCACT CGCGAGCCCC CAGTTTGCCG CATTAATTCC CCATCATCCT TCACCACCAC
AAAAAAAAAA GTGATTTGGA GAAGGATACG CTCCTCCAAA TAATTTTTAA CAAGTTCACC ACCACAACGA GGCACCGACA
ACCGCCATGA GTCCACGCAC CCTGCAGCTA GTCGTGCCAC CAGCACCACA GTTAGCCACA CCGCGAGCAA TCCACGCCAT
CACTTGCCGC TGTGAGTCCA CGATCACACG CCTCGATCAG CCAGCTGCCA TGATATGTCG GCTTGGGCTT GGATTCTGCA
ACATACCATG TCCCCATCGA TGGCACCACA CTCTAATTCG CCAACACAAC ACTGAAGGGA TCGGATCGGG AGGGCTAGCT
CACTCAAGAT AGTGACGGGA TGATTCGATG GGAATTCCAT GGGGAACAAA GCACAAAATC ATTAAAATGT CCTTTTCAAT
TCCATGGCAA ATTCCTAAAG CAATACTctc tctccattct ataatgtagg ttgcacactc atttcaagat tcaactttca
aaacatttga ctaacgattt gtataatata aattgaattt tatttgatag aaataatatt attggattga tatttcaata
tactttcata tggttataat tttgttacta caaactttat agtatattag aaattataaa taaaaaatta gttttgtaga
ccgtacatgc caagtttgac cataccatat tatgaaaaag agggagtaGT AACCTTGTTT ATATTTGCAA TATAtactcc
ctccgtttct aaatatctga cgctgttgac tttttaaaca tgtttgaccg ttcgtcttat taaaaaataa gtaattatta
attcttttcc tatcatttga tttattgtta aatatatttt tatgcagaca tatagtttta catatttcat aaaagttttt
gaataagaag aatgatcgtc aaatatttag aaacgagggg agtaTATTGC TAGTAAATTT TACTGTAAAG TCATGTTTCT
TCATGTGTCT TTTTTAGAAC ATTTCTTCTT CATGTGTTCC AATCAATTTT TTCGATCTCC ACCACCACTA CCACAGTTGT
ATGTGTAGTA GCTAGCTGTT GCACATGCTC ATGTTAATCT GAATCTGTCC ATGGTTTTTT GCAGGGCAAG AGGTGATGTG
CTACGAGAGC CCAAGGCCAA CCATGGGGAT CCACCGGCTG GTGTTCGTGC TGTTCCAGCA GCTGGGGCGT CAGACAGTGT
ACGCGCCCGG GTGGCGTCAG AACTTCAACA CCAAGGACTT CGCCGAGCTC TACAACCTCG GCTCGCCGGT CGCCGCCGTC
TACTTCAACT GCCAGCGCGA GGCAGGCTCC GGCGGCAGGA GGGTCTACCC CTAGCTAACG ATGATCCCGA TCGATCTGCT
GCATGCTCAC TATCATCATC CAGCATGCTA TACATTGCAG GTTCAGACAA TTGAAATGAT TCTCGACACA CAACATATAT
ATGATGGTGT AATTAATTAT GCAATTAAAT AGCTGAGCAA GGCTAAGGT