Os06t0160400-01

Locus

Os06g0160400

Description

Similar to Proline-rich cell wall protein-like.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HGW

CGSNL Gene Name

HEADING AND GRAIN WEIGHT

Oryzabase Gene Symbol Synonym(s)

OsHGW

Oryzabase Gene Name Synonym(s)

heading and grain weight, heading date- and grain weight-related protein

Transcript Evidence

AK121877 (DDBJ, Best hit)

Protein Evidence

B6TN35 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033104I02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0160400-01)

RiceXPro (AK121877)

Others

Oryzabase (15163)

KEGG (Os06t0160400-01)

Transcript

1070 bp

>Os06t0160400-01 Similar to Proline-rich cell wall protein-like.
cctctccgctccaattctcccccacccgcaaccgcgtcctcctccatccttcccggcgaa
gcgatccaccggcggcgaggcgcgtcagctctcacccgaggagctcagccccaccggcgc
gggcgcgcgcgcgcgcggcgaggatggactacgactaccggggcaggccgggctccggat
cctacggcggcggcgtcggcggcggcggggggtcgtcgtccctctacccgcgcgtcggcc
agccctcccacggcgtcgccaacgcgcccccgccggagccgccgcgggccgcgccGTACC
ACCACCATGGCCCCCCCACCGTCTCCGCGGCTCCGCACCCCGTCCCCGCCTCGTCCTCCA
CATCGATGGGCATACAAGTTGTGATAAAGCCAGCATATCGGATAACCCCTCCTCCTCAGT
TGCCGCCACAGCTTACAGAAATTCCTCGCAGTACCTTCAATTTTGATTTTGAGTATGAAA
GGAAAATTCTTGCTGAGGCTGAGAAGGAGAACCCCAACTGGAGCAAGTTTGTGATAGAGA
GTCAGCCACCACCACCACCACAGCCGCCAAGAGGCCCAAAACTCACAACTCCCACTACTT
CTGTGGCTACTCCAGGGGATCCAGTTGTGGACAAGTATATATCCATGGGGCTTGGACGTG
AAGCTGTCTCATTTGCTGTGTTGAACTATGGAGATAATCCAGCGAAGGTGAAGGAGTTTG
TGAAATCCTACAACGCTCTCCACGAGATGGGCTTCACATCCTCAAATGTTCCCGAACTGC
TGGCCATCCACGACAACGACCCTGACAAAGTTATCCAGCACCTGATCGGCACATCATAGT
CCAGAACAAAACTCTCCACATATTCCCCCATGTATAGGTCCATCTTACGCTGGCAAGCGC
CATACATGTCGCGTTTTTAATGATGGTTTCGAGTGCTAGCTATTGTACGCGTATTTCCGC
TACGAGTTTCATGAACTGACTATTGTTGTGCTTCCCAAGCGGTTTCATAAACTTAACCTT
GCTTTTTGTGTCGGATATATAGAGCCAGTAGGTGATGATTCTGATTGCTG

CDS

696 bp

>Os06t0160400-01 Similar to Proline-rich cell wall protein-like.
atggactacgactaccggggcaggccgggctccggatcctacggcggcggcgtcggcggc
ggcggggggtcgtcgtccctctacccgcgcgtcggccagccctcccacggcgtcgccaac
gcgcccccgccggagccgccgcgggccgcgccGTACCACCACCATGGCCCCCCCACCGTC
TCCGCGGCTCCGCACCCCGTCCCCGCCTCGTCCTCCACATCGATGGGCATACAAGTTGTG
ATAAAGCCAGCATATCGGATAACCCCTCCTCCTCAGTTGCCGCCACAGCTTACAGAAATT
CCTCGCAGTACCTTCAATTTTGATTTTGAGTATGAAAGGAAAATTCTTGCTGAGGCTGAG
AAGGAGAACCCCAACTGGAGCAAGTTTGTGATAGAGAGTCAGCCACCACCACCACCACAG
CCGCCAAGAGGCCCAAAACTCACAACTCCCACTACTTCTGTGGCTACTCCAGGGGATCCA
GTTGTGGACAAGTATATATCCATGGGGCTTGGACGTGAAGCTGTCTCATTTGCTGTGTTG
AACTATGGAGATAATCCAGCGAAGGTGAAGGAGTTTGTGAAATCCTACAACGCTCTCCAC
GAGATGGGCTTCACATCCTCAAATGTTCCCGAACTGCTGGCCATCCACGACAACGACCCT
GACAAAGTTATCCAGCACCTGATCGGCACATCATAG

Protein

232 aa

>Os06t0160400-01 Similar to Proline-rich cell wall protein-like.
MDYDYRGRPGSGSYGGGVGGGGGSSSLYPRVGQPSHGVANAPPPEPPRAAPYHHHGPPTV
SAAPHPVPASSSTSMGIQVVIKPAYRITPPPQLPPQLTEIPRSTFNFDFEYERKILAEAE
KENPNWSKFVIESQPPPPPQPPRGPKLTTPTTSVATPGDPVVDKYISMGLGREAVSFAVL
NYGDNPAKVKEFVKSYNALHEMGFTSSNVPELLAIHDNDPDKVIQHLIGTS*

5'UTR

chr06:3063464..3063606 (- strand) : 143 bp

CDS

chr06:3063241..3063463 (- strand) : 223 bp

chr06:3062249..3062295 (- strand) : 47 bp

chr06:3061111..3061302 (- strand) : 192 bp

chr06:3060701..3060803 (- strand) : 103 bp

chr06:3060238..3060368 (- strand) : 131 bp

3'UTR

chr06:3060007..3060237 (- strand) : 231 bp

FASTA

>Os06t0160400-01 class=Sequence position=chr06:3060007..3063606 (- strand)
cctctccgct ccaattctcc cccacccgca accgcgtcct cctccatcct tcccggcgaa gcgatccacc ggcggcgagg
cgcgtcagct ctcacccgag gagctcagcc ccaccggcgc gggcgcgcgc gcgcgcggcg aggatggact acgactaccg
gggcaggccg ggctccggat cctacggcgg cggcgtcggc ggcggcgggg ggtcgtcgtc cctctacccg cgcgtcggcc
agccctccca cggcgtcgcc aacgcgcccc cgccggagcc gccgcgggcc gcgccGTACC ACCACCATGG CCCCCCCACC
GTCTCCGCGG CTCCGCACCC CGTCCCCGCC TCGTCCTCCA CATCGAGTAA ATCCCTCCCT CCCCGCTCTG TGCATACTGA
ATCTCTGCAT AGTGAATCGC TGGGTAGCGC AGAAGAGAGA ACTGCGTGTC ATGTTTACTC GATCGAATTG TGAACAGCTT
ATTCTACCTG ATTGGATTGC GTGCTAGATT GGCAGATCTC ATGTTGTAAT CCGGTTGGAG GGGTATCGTG ATCCCGAGCG
ATTTATCCCT GAAACTGAGC TAGTTTGGTT TTGAGTTGTG CATTGAACTT CTACTACCAT TTGGTTTCTA GGTGGCTTGT
CAGACCTACC AAGCTTGTTC ATGCAGTAAA TTGCCTCGAT TTAATCATTT GCACATCGGT GTGATTAGTT AGTTCACCAT
GCTATGCTTC CTAGCTAGCA ATGAAAAAGG GGACGTACCG GGCACTTGTA TCAGCAACAA CAACAGAATT AGATTAAACC
TTGTCTTTGG ATAAGGGAAC GAGCTCTACT ACTGTTTATA TGTTCTAGTT GACCTCAGTA TAGGCCTAAA CATGGTCTCG
TTATGTACAA AATTGAGTTC TCAAAAGTAA CAGCTTTGTT TAGTTGAAAA TGCTGTACTT TCTATATTTT AAAGTGTGCG
AGAAAATCTG GCTTTTGCAT GTGTGCGTTT TTTCACTAGC CAAAGACAAA TAAATGCAAC AGCATAGGGT TCTTTCTGCA
CCTTTGCTAA TGAAACATTG ACTGTGGGAG TGAAAACATT GAAGTGTTTG TTTTAATGGT GTTTTCAACA TAGCCGAAGT
TGGTAAAATT GTAGAATTCC CTGGGCCCAT CGATATAATT TTTTTCCCAA AAGTTATTTG AAGACAAAAA TATTGGAACA
TCCCTGTTTT TACTGTTGAT ATCATGCCAG ATTTAGAAAC TGCCCTGTAG CGTTTCCTTT TTTGCCAATT ATCAAGAGCA
TGTTATTCAT CATTAATTGT TGTTGCTGCA GTGGGCATAC AAGTTGTGAT AAAGCCAGCA TATCGGATAA CCCCTCCTGT
AAGTCACTAA GTTTGTTatt cagtcatcac tttgctgtat tcacctacat gagaattgtt catctgcttt ggtaccaaat
tttctatttt aatGCCTGCA GGATGTTTGG TATAAATTCC CTTTATGTTT AGTTAAGATT GGTAATTCAA TTGGAGTAAC
TTGGTGTTTA TTTAGCAAAC AGCCAAACAC TGTTCTTTCA GATTCAAATT GATGCCTTCT AACTTTTGTG TATTGAAAGC
AGACATAAAT CATAGCGTCA TGATAGTTTT GAACTGCTGA AATTATCCTC CTTTGGCTTT TGAAAAGGAA CGAAGATATT
ATGTTGCAGT GTAACAGGAG ATATGGTTGT TTATAAACTG TCTCTCTGTA TATTGGTTTG TGCTTCTGTG CGTAAAATTA
GAGATGAGGA AATAGCTCCA CTACAAATAT TCACAAATAA TGGACTTCTA GTAGCATTAG CTCAGGATTC ACCTCTAGTT
ATTCAATCTG CATGGGGCTA TTATGTTCTG AACGCTCACA AATCTTAATG GTCTAGTTGT TTCTTGATGG ACTATTATGT
TGTTAGAAGC CCATCGTAGA AGATATAGAT AGTGCAGTTT ATTCCGTATA GTAGACTTTG TGGATGGATT CTGTTTGTTC
TTTTCCTTTA TTTATTTATT CATTTATTGG CCATTCCATT CTTTTACTGT GAATATGGTG TTCTAGTTGG TAGCTTGCAG
ACATGATTCA TACTATAATG GGCTCCCTCA AAACTTGTTC CATGTACTGC GCTTGCCTAG CTGTTCTTTC TAGAGACAAA
TGGCATCATC TTGCAAACTT CCATCTATTT TGCATATTTA TGCATCCTTC TTTGTTAAAT GCATCAACGT TTATTATCTA
CACTTCCCTC GTATATTTGA TCATTGGCCA TCCTCTAATG TGTGCTTTGC TTTTATTATT GCAGCCTCAG TTGCCGCCAC
AGCTTACAGA AATTCCTCGC AGTACCTTCA ATTTTGATTT TGAGTATGAA AGGAAAATTC TTGCTGAGGC TGAGAAGGAG
AACCCCAACT GGAGCAAGTT TGTGATAGAG AGTCAGCCAC CACCACCACC ACAGCCGCCA AGAGGCCCAA AACTCACAAC
TCCCACTACT TCTGTGGTAA TAATATCTAC ATAATTCTTG TCTTCCATAT AGTATTGTGT ATTACACAAA TAGTGCTAGG
TACTTAACAT CAGGGAGCAG GCTGTTGTTG AAAAATCGAT AATCCATTGC AAGGGCTAAT ATATAAAGTT CCTTGGGCAA
ATGGGGACTA ATACCCCTGA TACTCAAGAG ATTTTTCGCT TCTTGGCATC CTTTCACATG ATAGCAATAT CAGCTGTTTA
TAACAAGTTA GGTACCCTAG GAAGTTGTAG AGATGTAATG CCATCTCCCT AGAAAACTTA TTTTTATTTT TGCCCTTCTG
CAGGCTACTC CAGGGGATCC AGTTGTGGAC AAGTATATAT CCATGGGGCT TGGACGTGAA GCTGTCTCAT TTGCTGTGTT
GAACTATGGA GATAATCCAG CGAAGGCATG CTTTTTCCCT TATTTATCTT GTGATTTATC ATTACCTTCT TTCAACATAT
CATCAAGAAC AAAAACCATT GCTTTGATAA CTCAAAAAGG TTTTCAAAGG TCAACAAGAT AGCTATATAC AATCAGTATT
TGCAGAAGCA CTAGGGTTTC TTCTTCTAGC AAAACAGTGA TTGCCATTCT GTCCAGTTGG TAGTTTTTGT GGAATTCGAT
TTTCTACTTC TCAGGGAGAT AGAAGTGTCT TCTGCCATTC TAATCGCCAC GAGCATTTGT AGACAGTGGA AAAAAAAGAG
AGAGAAACTG ACAAGGATGA ATCCTATGTA CTTGCAGGTG AAGGAGTTTG TGAAATCCTA CAACGCTCTC CACGAGATGG
GCTTCACATC CTCAAATGTT CCCGAACTGC TGGCCATCCA CGACAACGAC CCTGACAAAG TTATCCAGCA CCTGATCGGC
ACATCATAGT CCAGAACAAA ACTCTCCACA TATTCCCCCA TGTATAGGTC CATCTTACGC TGGCAAGCGC CATACATGTC
GCGTTTTTAA TGATGGTTTC GAGTGCTAGC TATTGTACGC GTATTTCCGC TACGAGTTTC ATGAACTGAC TATTGTTGTG
CTTCCCAAGC GGTTTCATAA ACTTAACCTT GCTTTTTGTG TCGGATATAT AGAGCCAGTA GGTGATGATT CTGATTGCTG

Locus: Os06g0160400

Loading...

Locus: Os06g0160400

Loading...