Os06t0166500-01

Locus

Os06g0166500

Description

Similar to Auxin-responsive protein IAA20 (Indoleacetic acid-induced protein 20).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

IAA20

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIAA20

Oryzabase Gene Name Synonym(s)

Aux/IAA protein 20, Indoleacetic Acid-Induced 20

Transcript Evidence

AK102541 (DDBJ, Best hit)

Protein Evidence

Q5VRR0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein dimerization activity (GO:0046983)

Functional domain (InterPro)

AUX/IAA protein (IPR003311)

Aux/IAA-ARF-dimerisation (IPR011525)

Full-length cDNA

J033096K11 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0166500-01)

RiceXPro (AK102541)

Others

Oryzabase (10453)

KEGG (Os06t0166500-01)

Transcript

997 bp

>Os06t0166500-01 Similar to Auxin-responsive protein IAA20 (Indoleacetic acid-induced protein 20).
GTGGATTGCAGAAGATGATGCTGCAGTGATCCCGTCCACTAGCTGGTGAATTGGAGAGAC
GGATGGAGCTCGAGCTCGGCCTCAGGCTCGCGCTGCCGTCGCCGTCGCCGTCGCCGGCGA
CGGCGACGGCGGCTGGGAGTGAGCTTGACCTTCTCAACAGCGCGCCGGGGTCCTGCCGCA
AGAGGGGCTTCGAGGAGGCGCTCGGTGGGTTCAAAACCGACGACGACAACGACGACGGCA
ATGGCCGCGGCGGTGACGGCGATTCCGACGGCGAAATGGGCAACAAGAGGAGGAAGCTGG
TGGGGTGGCCACCGGTGAAGTGCTTGCACCGGCGGCGCGACGGTGGCTGCGGTGGCGGAT
ATGTGAAGGTGAAGATGGAGGGGTTGGCCATCGGGAGGAAGCTGGACTTGTCCATCCTCG
GCTCATACGCTGAGCTGCTCGACACGCTCCACCTTATGTTCCCCTCCACTAACCAAGAGG
ATGGGCACGATCGTCGTCGACGTCACCCATACGCTGTCACCTACGAGGATGGGGAAGGAG
ACTGGATGCAGGTCGGAGACGTGCCATGGGAGGCCTTTGCCAAGTCGGTGAAACGGCTCA
AGATACTGGTGTAACTGACTGCAAATTAAGCTACTAGTACTAGTCTTTACTACTTCGAAT
AAAATTGTACGTGAACGGGATTATTTTGTTCACGTTTCTCTCATCATAAATGTGTAGTGT
TTCAGCAATTTCATAAGCATGACGAATGAAATCTCGTAGCTGTTGTCATCAATCACCTTG
CATTTCGTGTCAAACTACATCTGTGGCCAGCGCACAGTAGTGTTAGTATAGTGTACACCG
TAGAGTCACCTCGCTGTGATCAGCACGTGCATGCATCTGTATAATACACCGCCACATATG
CACAGGATGGTACTGAATACTGAGCATATCCTGTACGGGGAGTTCAGATATGGGTGTTAT
GGCCTAccaaagtgaatcttatcacatttttttaatc

CDS

552 bp

>Os06t0166500-01 Similar to Auxin-responsive protein IAA20 (Indoleacetic acid-induced protein 20).
ATGGAGCTCGAGCTCGGCCTCAGGCTCGCGCTGCCGTCGCCGTCGCCGTCGCCGGCGACG
GCGACGGCGGCTGGGAGTGAGCTTGACCTTCTCAACAGCGCGCCGGGGTCCTGCCGCAAG
AGGGGCTTCGAGGAGGCGCTCGGTGGGTTCAAAACCGACGACGACAACGACGACGGCAAT
GGCCGCGGCGGTGACGGCGATTCCGACGGCGAAATGGGCAACAAGAGGAGGAAGCTGGTG
GGGTGGCCACCGGTGAAGTGCTTGCACCGGCGGCGCGACGGTGGCTGCGGTGGCGGATAT
GTGAAGGTGAAGATGGAGGGGTTGGCCATCGGGAGGAAGCTGGACTTGTCCATCCTCGGC
TCATACGCTGAGCTGCTCGACACGCTCCACCTTATGTTCCCCTCCACTAACCAAGAGGAT
GGGCACGATCGTCGTCGACGTCACCCATACGCTGTCACCTACGAGGATGGGGAAGGAGAC
TGGATGCAGGTCGGAGACGTGCCATGGGAGGCCTTTGCCAAGTCGGTGAAACGGCTCAAG
ATACTGGTGTAA

Protein

184 aa

>Os06t0166500-01 Similar to Auxin-responsive protein IAA20 (Indoleacetic acid-induced protein 20).
MELELGLRLALPSPSPSPATATAAGSELDLLNSAPGSCRKRGFEEALGGFKTDDDNDDGN
GRGGDGDSDGEMGNKRRKLVGWPPVKCLHRRRDGGCGGGYVKVKMEGLAIGRKLDLSILG
SYAELLDTLHLMFPSTNQEDGHDRRRRHPYAVTYEDGEGDWMQVGDVPWEAFAKSVKRLK
ILV*

5'UTR

chr06:3346257..3346318 (- strand) : 62 bp

CDS

chr06:3346033..3346256 (- strand) : 224 bp

chr06:3345732..3345922 (- strand) : 191 bp

chr06:3342995..3343088 (- strand) : 94 bp

chr06:3342847..3342889 (- strand) : 43 bp

3'UTR

chr06:3342464..3342846 (- strand) : 383 bp

FASTA

>Os06t0166500-01 class=Sequence position=chr06:3342464..3346318 (- strand)
GTGGATTGCA GAAGATGATG CTGCAGTGAT CCCGTCCACT AGCTGGTGAA TTGGAGAGAC GGATGGAGCT CGAGCTCGGC
CTCAGGCTCG CGCTGCCGTC GCCGTCGCCG TCGCCGGCGA CGGCGACGGC GGCTGGGAGT GAGCTTGACC TTCTCAACAG
CGCGCCGGGG TCCTGCCGCA AGAGGGGCTT CGAGGAGGCG CTCGGTGGGT TCAAAACCGA CGACGACAAC GACGACGGCA
ATGGCCGCGG CGGTGACGGC GATTCCGACG GCGAAATGGG CAACAAGTGA GTGATCGCAT GCACGCAATC GCACCTCTCG
TCCATTTTTC GTCGTTGTTC GTGTCACTGG GTTGTGGCAT TTGTGTACGT ACGCAGCTGA GGTGAGTTGC ATGTAGGAGG
AGGAAGCTGG TGGGGTGGCC ACCGGTGAAG TGCTTGCACC GGCGGCGCGA CGGTGGCTGC GGTGGCGGAT ATGTGAAGGT
GAAGATGGAG GGGTTGGCCA TCGGGAGGAA GCTGGACTTG TCCATCCTCG GCTCATACGC TGAGCTGCTC GACACGCTCC
ACCTTATGTT CCCCTCCACT AACCAAGGTA GTACTAGTat ctattatatt attatattat taagacagcc ttgaaaggag
gcaccacgtt cactgtggag gctagaaatt cccacattaa tcagagaaaa gaaaaaAAAT ACACGCCGTT AGATTATAGT
GGGTCCAAAC TATAACGCTT GAGATCTTTC TTGACAGATA TAGAAAGATA TATTCTAAAA TAGAGTGTAG AAATAATCCG
ATCGAATCAT CTATCTGATT ATCTAATTAG TATTTGCTCA TTGTTTCCGA CTCTGATTGT CAAACCGAAA CAAATTAATA
CCCCTGGACA TATGCCAGCT AAAAAAAAGA GCTTTATTAA TGTATGTTTT TGCCGGACGA TGACTATTTT CAGGCCAAAA
AGAAAAAAAA ATCAGCCAGC GTCCGGTAGT ATCCATATAA ATTAGCAGGA ATAAAATTTA AAAATAACTT AAACTTGGAA
CTAAAAATAA GCAATGTTGA ATGAAAGAAG AGTCCATATA AGAACCCAAT ACAAGATTTA TTAAAATTAG GAATAAAAAT
AAAATAAAAT CCAAAATTag aaaaaataaa gaaaagaaga gttcaagtag gaatacaatt taaaaataac ataaattcga
aattaaaaat aagcaatgtt gaaagaatag tccatataag aacccaatac gagtaaaatt cggataaaaa taaaataaaa
tccaaaatta aaaaaaaaag aagagttcag gaatataatt taaaaataaa taaaattcga aattaaaaat aaaaaatatt
gaaataagtc catataagaa cccaatacgg gattaattaa aatttgaaat aaacataaaa taaagtctga aaatttgaaa
attaaaaaga gagtttaagt agggatacaa ttttaaaaca actgaaaGTG AAAATAaaaa ataaggaata ttaaaataat
agaccatata gaacacaata tgagattaaa ttaaaattca aacaagtaaa agattaatac tgaaattaga aaaaaaaaag
agttcaacta ggaatacaat ttgtgaataa ctaaaattcg taataacatg attattgaaa gaagagacca tcaacacttg
acaagattga ctgaaattcg gtataacaaa taaaataaat tccaaaaata gaaaaaatat tataagagtt aagtagaaat
ataatttata aataaataaa atatcggaat gaaagatgtg gaatttttga aaaaaaatat ataaaacaca acgatgataa
atgacaataa agaggggaga aacaacaggt ctatcaagga gtagagtcgt gacggttgac gggacatcta aaaactatta
acaaacctca aatagaaccc caacaatgat taaaattggg acggcggata tgtccttaag cagcacggtc acgaagtatg
gcgggacttc aaagagaaaa ataaacgcca atgataataa tgttcgattt taaaatctca atgacgataa agaggggagg
cagcgggtag ccgtagagga gtacagcggg tcttctaaaa aaataaaata atgaacccaa acgataatta ttttcaaatt
ttaaataaca ataacaataa agagagaaag caacgtacat gccatagatg agtatagtga caatgtttgg cgggacttct
aaaaattata aaaataaaac ccaacgagac aataaacttt aaaatctata agatccaatt ttaaaagttc caaggagaat
gaatagaaac agtgatagat cgagccagca aataaaggag aggtgacaaa gaagtaagag gtagcatctc gcatataact
tttaaaagct actccctccg tcccagaata taagaagttt tagagttgga cgcggttatt aggaaagtag gtagaaataa
atggcgaatg gttgtgattg gatgagtagt ggaggtaggt ggaaaaagtt aatggtggag ggttgtgatt ggttgggaag
ataatgttga tggagaagtt gttatatttt aagaaaaatc gtaagggcta aaaattgtta tattttggaa tagagggagt
aTAAAACTAG AAACACGGGG ATTATAAGGT TTGATCTTTC AAAATCTTAA AATACTGATA TAACTATTTA ATAAATTTTA
AGTAAAATCA TATTAAAAAG TAGATAATTT TATATGAGTG CTAGCCGCGC AATTGCGCGG GCCGCCCAGC TAGTTATACT
AGTAGTACTA GGGAATAGAT CATCTGCAAT ATTGCTCTCA AGTGGTCGAT TGATGAAATT CATAACTACT AACTGCTGAA
ATTTATAACT GGAGTACTAA CTACTAACAG TTCACTGATA CGACCTACGT CAGAAAATAT TTAATACTCC ATCCGTCTTA
AAATATAAAT ATTTTTTATG GTCGCCGCTA GCCATTTTTA ACTTGTGGCG GAGACTCATC GGATGGTACC GGTAGTTACA
TGCATGTCCC TATCACTTTG CACAAACACC CTGCCAAACA AAAAAGAAAA AGAAAACTAC ACACTATTTG AAACCGCTTA
AATAAACACA AAATTCCCTG GAGCCCATTT GGCGCATACT CCGAACATTT CAAAATTCAA GTTGAAGCGA ACTTAAAATA
TTAAAAGGTT GCAATTTGAT GGTGGTGCAG AGGATGGGCA CGATCGTCGT CGACGTCACC CATACGCTGT CACCTACGAG
GATGGGGAAG GAGACTGGAT GCAGGTCGGA GACGTGCCAT GGGAGTAAGT TCATTTCTTC CCGGCATTGT GTCGCCATCA
CAAAATTATT TAACAATTTC ATCAAACTTG ACTACGAGCC TAACGGCGAG TCTGAATTTT CATTTGCAGG GCCTTTGCCA
AGTCGGTGAA ACGGCTCAAG ATACTGGTGT AACTGACTGC AAATTAAGCT ACTAGTACTA GTCTTTACTA CTTCGAATAA
AATTGTACGT GAACGGGATT ATTTTGTTCA CGTTTCTCTC ATCATAAATG TGTAGTGTTT CAGCAATTTC ATAAGCATGA
CGAATGAAAT CTCGTAGCTG TTGTCATCAA TCACCTTGCA TTTCGTGTCA AACTACATCT GTGGCCAGCG CACAGTAGTG
TTAGTATAGT GTACACCGTA GAGTCACCTC GCTGTGATCA GCACGTGCAT GCATCTGTAT AATACACCGC CACATATGCA
CAGGATGGTA CTGAATACTG AGCATATCCT GTACGGGGAG TTCAGATATG GGTGTTATGG CCTAccaaag tgaatcttat
cacatttttt taatc

Locus: Os06g0166500

Loading...

Locus: Os06g0166500

Loading...