Os06t0184700-00

Locus

Os06g0184700

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MRP12

CGSNL Gene Name

MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 12

Oryzabase Gene Symbol Synonym(s)

OsABCC12, OsMRP12

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCC subgroup member 12, multidrug resistance-associated protein 12

Transcript Evidence

ab initio prediction

Protein Evidence

B9FRW1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC transporter, conserved site (IPR017871)

Expression Databases

TENOR (Os06t0184700-00)

Others

Oryzabase (11963)

KEGG (Os06t0184700-00 (EC:3.6.3.44))

Transcript

1890 bp

>Os06t0184700-00 Hypothetical conserved gene.
ATGGATTTCGTCTGCCCCGGCGATCCCGCGGCGTGGGACGGGAGGCGATTCACCCCGTGT
TTCTCCGATTTATATCCTTTGGTTTCGTTCGAGAAATTTGGTGGTGTTCGTGGTCTCTGC
GATGGCGCCTGCCTTTCTTTTCTTGAAATAGTTATGCTTATAAAGAACAAAATTGAGGGG
AAAGATGTTGTGAACTACGAGTCGTTCTTCAGGTCCTCCCAGTTTCTTGTGTGGATGGTT
GTAGGTCTTGTCTCAGTCCATGGACCTTGGTTCGTATTCTACAACCCAATCATGTGTTTC
TGCTGGATTTTGAAGATTCTTCTTGAGATACCTCATTTGCAGTACAAGCTCACAGTATTA
AAGGCAGTGTTATATTTTAAGGAGATCATCTCATTCTCTATGGCAATTGTATTTGGCCTC
TTTGTAGTTGTGTCTACTGTAGTGGACCAACCACACAATAAAAGAGAAATGAACTCTATT
GAAGATCCCCTTGTTCCAGATGATGAAAAAGCTGAGGCTGAAGTGACCAACTTGGAAAAT
AACCAAAGTATCTGGGAGTTGTTGACCTTCAAGTTCGTTAATCCAATGATGGATATTGGG
ATCACAAGACAACTCGATTTCACTGATCTACTTGAATTGCCAGTTGAGCTTAGAGCTGCT
TCCAGTTATGAGAAACTTCTGTCTTCGTGGACTGTTGAACATCAACGTCACCATGCTGAT
TCATCTCTACTTAGAGCCATGTCTAATGCTTATGGATGGACTTACTTGCGTTTGGGACTG
TTAAAGGTCTTCACTTGTGTTGCACTGTTCAACACATTGATACCACCATTAAACTCATTC
CCATGGGTTATTAATGGAATGATTGATGCTGTTATCTCTAGCAGAAGGTTGAGCAAGTAC
TTATCCAGTCCAGAGAAGCGTTCTTCTGCAATACCTGTCTCAGCTGATCTTTTAAAGCAT
TGCAATACTGAAACAAATGTCAATGCCATGGCTGTCATTCTTCGTAACGTTTGTTGCTCT
TGGTCTAGCAGTTCTATTGTTGAATCGAGCATGATTTTGAGAGACGTATCTCTGGAGCTA
CAGAAAGGAATTTTTGTTGCAATCATAGGAGAGGTTGGTTGTGGCAAATCATCTTTGCTG
AACTCTATCATCGGAGAAATTCATGTTACCAGTGGTTCCATTACCTCCTATGGTTCAATT
GCATATGTACCACAGTTCAACTTGGTAAAGCATGTCGCGGATGTTGTGCAGGTGCCTTGG
ATACTGTCTGGTTCATTGCGAGATAATATTTTGCTTGGAGAAGAATTTGATCCAAGGAGG
TACGAAGAAGTGATACATGCTTGTACCCTTGATGTTGATATCTCAGCAATGGTTGGGGGA
GATATGTCACATATTGGAGAGAAAGGTCTTAACTTATCTGGTGGACAAAGAGCCCGTTTA
GCCTTAGCAAGGGCTTTGTATCATGACTCTGATGTTTACTTGTTTGACGATGTACTTAGT
TCAGTTGACTCACAAGTTGCTTCGTATATCTTGGAAAAAGCCATTATGGGGCCCAAAATG
AAGAGAAAAACACGAATATTAAGCACCCACAATCTTCAGGCAATTTCCGCAGCAGATATG
ATAGTGGTCATGGCTAATGGGCTTGTTAAGTGGTTTGGGACGTTGGACTCTTTCTTAGCA
ACTCCATACTCGACACTGTCTAAGCCAGAGAGTTCAAGGGTTATCTCATCAACATTTTCT
GAGAAAAACAAAGGAGTGAGCGTCGCCCATGAATCCGAGACTAATGGCCTGATTGACAAT
GACTCAGTAGTTGATCACGAGGAACAAAGAGAGCAGAATTCTGTAGAGGCCAGGAAAGAA
GGCATGGTAGAGCTTAGTGTGTACAAGTGA

CDS

1890 bp

>Os06t0184700-00 Hypothetical conserved gene.
ATGGATTTCGTCTGCCCCGGCGATCCCGCGGCGTGGGACGGGAGGCGATTCACCCCGTGT
TTCTCCGATTTATATCCTTTGGTTTCGTTCGAGAAATTTGGTGGTGTTCGTGGTCTCTGC
GATGGCGCCTGCCTTTCTTTTCTTGAAATAGTTATGCTTATAAAGAACAAAATTGAGGGG
AAAGATGTTGTGAACTACGAGTCGTTCTTCAGGTCCTCCCAGTTTCTTGTGTGGATGGTT
GTAGGTCTTGTCTCAGTCCATGGACCTTGGTTCGTATTCTACAACCCAATCATGTGTTTC
TGCTGGATTTTGAAGATTCTTCTTGAGATACCTCATTTGCAGTACAAGCTCACAGTATTA
AAGGCAGTGTTATATTTTAAGGAGATCATCTCATTCTCTATGGCAATTGTATTTGGCCTC
TTTGTAGTTGTGTCTACTGTAGTGGACCAACCACACAATAAAAGAGAAATGAACTCTATT
GAAGATCCCCTTGTTCCAGATGATGAAAAAGCTGAGGCTGAAGTGACCAACTTGGAAAAT
AACCAAAGTATCTGGGAGTTGTTGACCTTCAAGTTCGTTAATCCAATGATGGATATTGGG
ATCACAAGACAACTCGATTTCACTGATCTACTTGAATTGCCAGTTGAGCTTAGAGCTGCT
TCCAGTTATGAGAAACTTCTGTCTTCGTGGACTGTTGAACATCAACGTCACCATGCTGAT
TCATCTCTACTTAGAGCCATGTCTAATGCTTATGGATGGACTTACTTGCGTTTGGGACTG
TTAAAGGTCTTCACTTGTGTTGCACTGTTCAACACATTGATACCACCATTAAACTCATTC
CCATGGGTTATTAATGGAATGATTGATGCTGTTATCTCTAGCAGAAGGTTGAGCAAGTAC
TTATCCAGTCCAGAGAAGCGTTCTTCTGCAATACCTGTCTCAGCTGATCTTTTAAAGCAT
TGCAATACTGAAACAAATGTCAATGCCATGGCTGTCATTCTTCGTAACGTTTGTTGCTCT
TGGTCTAGCAGTTCTATTGTTGAATCGAGCATGATTTTGAGAGACGTATCTCTGGAGCTA
CAGAAAGGAATTTTTGTTGCAATCATAGGAGAGGTTGGTTGTGGCAAATCATCTTTGCTG
AACTCTATCATCGGAGAAATTCATGTTACCAGTGGTTCCATTACCTCCTATGGTTCAATT
GCATATGTACCACAGTTCAACTTGGTAAAGCATGTCGCGGATGTTGTGCAGGTGCCTTGG
ATACTGTCTGGTTCATTGCGAGATAATATTTTGCTTGGAGAAGAATTTGATCCAAGGAGG
TACGAAGAAGTGATACATGCTTGTACCCTTGATGTTGATATCTCAGCAATGGTTGGGGGA
GATATGTCACATATTGGAGAGAAAGGTCTTAACTTATCTGGTGGACAAAGAGCCCGTTTA
GCCTTAGCAAGGGCTTTGTATCATGACTCTGATGTTTACTTGTTTGACGATGTACTTAGT
TCAGTTGACTCACAAGTTGCTTCGTATATCTTGGAAAAAGCCATTATGGGGCCCAAAATG
AAGAGAAAAACACGAATATTAAGCACCCACAATCTTCAGGCAATTTCCGCAGCAGATATG
ATAGTGGTCATGGCTAATGGGCTTGTTAAGTGGTTTGGGACGTTGGACTCTTTCTTAGCA
ACTCCATACTCGACACTGTCTAAGCCAGAGAGTTCAAGGGTTATCTCATCAACATTTTCT
GAGAAAAACAAAGGAGTGAGCGTCGCCCATGAATCCGAGACTAATGGCCTGATTGACAAT
GACTCAGTAGTTGATCACGAGGAACAAAGAGAGCAGAATTCTGTAGAGGCCAGGAAAGAA
GGCATGGTAGAGCTTAGTGTGTACAAGTGA

Protein

630 aa

>Os06t0184700-00 Hypothetical conserved gene.
MDFVCPGDPAAWDGRRFTPCFSDLYPLVSFEKFGGVRGLCDGACLSFLEIVMLIKNKIEG
KDVVNYESFFRSSQFLVWMVVGLVSVHGPWFVFYNPIMCFCWILKILLEIPHLQYKLTVL
KAVLYFKEIISFSMAIVFGLFVVVSTVVDQPHNKREMNSIEDPLVPDDEKAEAEVTNLEN
NQSIWELLTFKFVNPMMDIGITRQLDFTDLLELPVELRAASSYEKLLSSWTVEHQRHHAD
SSLLRAMSNAYGWTYLRLGLLKVFTCVALFNTLIPPLNSFPWVINGMIDAVISSRRLSKY
LSSPEKRSSAIPVSADLLKHCNTETNVNAMAVILRNVCCSWSSSSIVESSMILRDVSLEL
QKGIFVAIIGEVGCGKSSLLNSIIGEIHVTSGSITSYGSIAYVPQFNLVKHVADVVQVPW
ILSGSLRDNILLGEEFDPRRYEEVIHACTLDVDISAMVGGDMSHIGEKGLNLSGGQRARL
ALARALYHDSDVYLFDDVLSSVDSQVASYILEKAIMGPKMKRKTRILSTHNLQAISAADM
IVVMANGLVKWFGTLDSFLATPYSTLSKPESSRVISSTFSEKNKGVSVAHESETNGLIDN
DSVVDHEEQREQNSVEARKEGMVELSVYK*

CDS

chr06:4250861..4250890 (+ strand) : 30 bp

chr06:4251020..4251116 (+ strand) : 97 bp

chr06:4252392..4252498 (+ strand) : 107 bp

chr06:4252599..4252727 (+ strand) : 129 bp

chr06:4252941..4253041 (+ strand) : 101 bp

chr06:4253710..4253779 (+ strand) : 70 bp

chr06:4254263..4254514 (+ strand) : 252 bp

chr06:4258026..4258106 (+ strand) : 81 bp

chr06:4258205..4258450 (+ strand) : 246 bp

chr06:4258853..4258954 (+ strand) : 102 bp

chr06:4258994..4259097 (+ strand) : 104 bp

chr06:4259223..4259354 (+ strand) : 132 bp

chr06:4259466..4259613 (+ strand) : 148 bp

chr06:4259687..4259977 (+ strand) : 291 bp

FASTA

>Os06t0184700-00 class=Sequence position=chr06:4250861..4259977 (+ strand)
ATGGATTTCG TCTGCCCCGG CGATCCCGCG GTGAGCTTCT CCTAAAACCC TCCCAATCCC CTTCCTCCTC GTCGGAGTCG
AATGCTGGAG CAGCGATCAT GAGAGTTTTT TTTTTTGGTT TTGTTTTCAT TTGAAGTGAT GTTTTTTTTT TGGGTGCAGG
CGTGGGACGG GAGGCGATTC ACCCCGTGTT TCTCCGATTT ATATCCTTTG GTTTCGTTCG AGAAATTTGG TGGTGTTCGT
GGTCTCTGCG ATGGCGGTTG ATCGCGCTTC GGCTTCGGCG CGTTTGTGTT TGCGTGGTTT ATTGTGTTGT TTAGGCCTTA
ACATTCTACG GTGTTGGGAT TGAGCGGAAA TGTGGTTGCG GCTGGTGCTG CCGTTGTGCT CTTCATCTCC AGGAGGAACG
CGCGGAGAAC TGAGGTAGTA GATCTGCTCT GTTTATTGCC CTTTGTCAGC AAAATTCACG AGTACAAACT ACAAAGTCGT
AGGAAGGAAA TGGATAATCG GTTTTTGAAT TCACAATGTC TATGGAAATC AAACTTCAGG AGTACAAAGG TGTAGGAAGT
GATCACTAGC GTTAGCGGGG CATTGGCTTA ATTTCCAACA AATTGTTCAC ATGTTTGCTG CAATTTCTTT TGTTAGGTAT
CTGAAGTGTG AACTAGTCAT ACAAATGTTT GTTTCATAGC TAAGATAACA TCGTATCCAG AGTAAAAAAA AACATTGTAT
CAGCATGTCT CGCATGTTGG ATGTGAATTG GTATTTCATA TAGATGAAGC TTTTATGGTT GCATTGCTGA TTGTTTCTGT
TTTTGGAATG ACGGTGTTCA GTAACAGATA TGGTTGAGAT TATAAACGGG ATAGTGGAAG CTAAAGCTAT TTATATTCAC
AACTGATGGT ATGAGTTGTT AGGAACTTAG GATAGCGTGA ACTTCAAGCA TAATGATGTT TTTGTGCACG AAGTGGCAAA
AACAGGGGTC ATTCACTATA CTTCTACTAA ATTAAATAGA GGCCGAGATC CTTTTATTGA Atactacctc cgtttcaagt
tataagactt tctagcattg tccacattca tatagatgtt aatgaatcta gacacacata tatgtctaga ttcattaata
tatatataaa tgtgggcaat gctagagtct tataatatga aacggaggaa gtaACTTATT TGGACTTTGA AACCATTGGG
TTTGCTTTGA CTCAAGAAAA TCTTATCATA ATTAGTTTCA GCAATCTAGT TCGTATTCTA TGTTTTTGTA GAAACAATAC
TTGAACGTTC TTTTTCTTGA AAAGAACAGT AGGACCAAGA AGGTCCAACT ATTAATTTAT TATAAATGAA AGATAAAATG
AAGCACTCAA ACCATGTTAC TTAAGCTTGA TAATTAGCAT CAATTTTTGC TTTATGTTGT TTATTATCTT TTACTGAAAT
ATTCTAATAT ATTAATTTTG CCTATTGCTT TAGAATGTCA GGATGGGTTT TCTGGAGAAG TGGTTTGTTT TCGGTGTGCC
TGGTTTTGCA GCCTGCCTTT CTTTTCTTGA AATAGTTATG CTTATAAAGA ACAAAATTGA GGGGAAAGAT GTTGTGAACT
ACGAGTCGTT CTTCAGGTCC TCCCAGTTTC TTGTGTGGGT AAGAACTTCA TTACTGTGAG TCTGTGAAGA TTGTGCTCTA
CCTTTCCAGT CATACAAATT ATTGAAAACA AACTGTTATA GTTGGTGCCA TTGAATAGAT GGTTGTAGGT CTTGTCTCAG
TCCATGGACC TTGGTTCGTA TTCTACAACC CAATCATGTG TTTCTGCTGG ATTTTGAAGA TTCTTCTTGA GATACCTCAT
TTGCAGTACA AGCTCACAGT ATTAAAGGTA TTTTGTTATT TTACAATATT TCTTCCTTTC CCTTTACATA TTGTTCCGTT
TTGATATGAA TTATGACATA TTTATACAAT TTCTTCTGTT TTATGATATT CTTCGTGTTC ATTGTAGTGT TTAACTTGAC
AACTGTTGCA TGCAAATTGG CAAGGAACAG GTGTTCAAAA TAGACATCTA ATCTATTCTT TTATTTGGAA CTCTTTACAG
GCAGTGTTAT ATTTTAAGGA GATCATCTCA TTCTCTATGG CAATTGTATT TGGCCTCTTT GTAGTTGTGT CTACTGTAGT
GGACCAACCA CACAATAAAA GGTATTTGGT TTGATCCTAA TATGCCACTC ATTTTCTCAA TGACATGCGG GCTGTGGGGT
CACGGCCCGC CATGGTACTG AGTTACAGTA GATTTCTCAA AAGTTCATCA GCAAATAAGT AATCCTTTTA AATTATTCTT
CTGCACGATT CTGTTATCTT TAGCAACTGC AAAAGTAATG CTCCCAATTG TCAGATGTCA ATTGCCAACT GTCAATTTGA
GCTTTGGTCA ATCATATGTA ACTCGAAGTG TAAATTCTGC TGTTTATGCA GAGGTAGCCG GTTAAACGTT AACCGAACAT
ATCCTGGGTT TTAAGTTATA CTTGGGAGCT ATACATATTG TTTGTCAACT CTAGCTAAGT CATGAATATG TAGGGTATGC
AACTTTTGAT TAGTAGGTAT TATTAGTAAG CTCATGTGCC ATGTTGTATC GTGCATGTGA AGTTGATGCA ATGAGGCAAA
GTTAACTATA GACGAAGTTA TTTCTTTTGG AGCCATGAAT CCTGATGCAT TTGTTCATGT CCTTCCCTTT AACCTAGGCA
TATCAGACTT AGTTATTACG GGAACAACAA CCTAGCTACT CTTTTGTTTT CTTCGTTACA TATCTAATGG TTAATGATCC
TGTTCCTCAC AATTTCTCTA AAGCTGCTTT TAAATCCATG CTATTTTAGA GAAATGAACT CTATTGAAGA TCCCCTTGTT
CCAGATGATG AAAAAGCTGA GGCTGAAGTG ACCAACTTGG TATGTTATTT TTGTCATGAG CTATTTGGGT TTCTGTGTAC
AATCAAACCA TTCTACCCAG ATCATAATGT TTATGTTGGT TAGCGTTGGT CCTACATTAA TCTTATCTAA CTGTCTGAAG
TAAATGTGAG CTTCTTGCCC TAGGAAATAC ATTATTTTTA ATACGTCTGT AGAATGTTAT TTGTGTGTTG CACGGCAGGC
ATGTTTAACT GCAAATGCTA GAGCACCAAT TTCTGGAAAT TACAATCGTA AAGCTGACAG GTTACAAATT TTTGCATAGA
ATGTACATTT GTGATGGCAT GGTGGTAATA GTGGAATCAA ATGTAATGGT CCTGCTGACT TGTAATTCAA ACCTGCAAAC
ATGTTATAAT TTAATTATTT TGAATTTGAA CATTTGCACG CTCTTCTGTT ATATTCATTT CTTTCTATTG AGAAAATTAA
ACTGTCCAAA TTTTGAATGT TTCATATGCT TTATCCTCTC AGGAAAATAA CCAAAGTATC TGGGAGTTGT TGACCTTCAA
GTTCGTTAAT CCAATGATGG ATATTGGGAT CACAAGACAA CTCGATTTCA CTGATCTACT TGAATTGCCA GTTGAGCTTA
GAGCTGCTTC CAGTTATGAG AAACTTCTGT CTTCGTGGAC TGTTGAACAT CAACGTCACC ATGCTGATTC ATCTCTACTT
AGAGCCATGT CTAATGCTTA TGGATGGACT TACTTGCGTT TGGGACTGTT AAAGGTACTT CTTTTTCCTT ATTATCGAGC
AGGTTGGCAT AGTAAATGCA TGCTGCTAGA TATGCACTGA AGGTACCTTT ATATAAAAAT GAACTAAAGG TGTGGGATTC
TACTTTCTGA AATTGCGTTA GGAATTTATG ATAAAATAGT TGATGATCTC TTTTATATCA CCCTTGTTAT AACAATGTTG
CCTATCTGAC TTGATTAACC AAAGTAGAAA AAAACATGCA TTACTTGCTG GGATGGTCTT CTTCTACATG CTTTAGAACA
GACATAATAT GTTGCGAGAT GCTAGAAGGT CAATAAAAAG GGGGTTAGTG AACTCTGTTT AGACTCAAGA CATTCCATTT
TGTGTAATGA ATGTTAACAA AGTTTTTTTT TTGGAAAATA GACACGAACC CTTATTTGCA AACATATGAT CATACATTCA
TACAGCAAGT CTGAACGGGT GCAGAATGTG TTTATTCTCT GATACATTAT ATTTTTTTTC ATGCATGCAG GTGATAAATG
ACAGCATTGG TTTTGTTAGC CCACTTTTAC TCAACAAGTT TATAAAATTT CTTCAACAAG GTATCATCCT TTTAGAAGGT
TGCAGGGCTG ATTATTAATG TTTTTGGAGG CAATAACTGC TATATTCAAT TTTGGCACTA AAAATTGGCA GTATGTATGG
TTAGTTGAAG TTTTCCTTTA GTTCACTTCA TATGGTCTGT GTCAGGCAAA CCAAACATCA TTTTCAACCT TTAGGACTCT
GCTGGTAGTT CTCGTAGAAG CAGATTGTAT ATTTGGTCTT TCAAATCCAT AAAATATGTA TATAGAGGTC TTCTTGTAAA
GAAACACTAT AGTTGTTTAA AGCTCCTTAT CTAATTAGCA TCTACTTTGC TGGTTTATTT TTGCTATTTA ATTTTCAGCA
ACGTTAATAA ACCAATCTGC ATCTGTTTTT CTACATTTCT CAGGTTCTGG TGGTGCTGAT GGATATATTC TTGCCATTTC
CCTAGGATTA ACTTCCATTA TCAAGTATGT CTTGTTACCA GAAATAAGTT TGGCTTCCCC ATATCCATGT ATTGTAAATT
TGTGCATGAT TTTTGTGCAC CCTAAAACTT AGATACTTCT AAACATCTCT TTTTAACTCC TTTAGTTTTG AATGTATAGA
GATAGTATCT GAACCTATTA GATATAATAT ACACTGGTAA CTTATGAGGT TTAACTGAAA CTTCAACAAT ATTATCCATT
AAGAGTGTTT ATGTTGATGC TTCAACTCTA GTTCTGATCA GTTTTAGGTA TTGAAATTTT GTCTCTGGTA AATCTGAACT
TTATTTTTTT TTTTTGGAAA AACTAATCTT CATTTTTTTT TTTTGCAAAT TCCACTTTAA TTTTTCTGCA AATTCCACTT
TTAAATTTTT CTGCGAATTC CACTTTTACA AGGTATGTTC AAATCCTCGT TGAGTTGGGC ATGCCAAATG TTGACACAAA
TGAATTGTTT TTACCTTTTC AATGAACAGT TTTTTTTAAT GAAAAGCTCT GTCACTCAGT TATGTATCAC CTCATTTATT
ATCATATGTT TTTTTACATT CTTGTTCACA TTCACTAGGT CGTTTTTAGA TAGTCAGTAC TCCTTTCGTC TAGCTAAGCT
AAAGTTGATG TTACGATCAA GCATCATGGG AATAATTTAT CGGAAGGTAT GACCATTCCT ATTCTTTACC TGTAAGTGTT
ATCCTATATA TTTTTTTAAA GAAAAAGTCA AGCAATTCAA ACATGTCCTG TCTATTTGCG TTGTACAATA ATTACCCCTT
TAGTCAATGT GCAAAAATTT CACACATATT TTTGCATTAA GAAGAGGTAT CAAACAGGCA ACATCTGGTA CAAACACTGA
AATTATAGGG AGAGGAGAAA AAGTCTGAAG GGTGCTCTAG CAACACTAAG AGTACAAACT TGTTGGACTT TCTTAAGCAT
GGCTGATCTT GTTCTTTGAT AATACCACAA TGTAGTATCT AATTGCACTC CTAAAAATAA TGCATATGCA GTTATGCATC
GTTATTTTAT AGTGTATAAC TGCGGTAGCA TATCTTTTAT GATTCCTGTA TATGTCCTCT TGTTCTGCCA GTTCAACGCT
GGAGGCTCGA ATTTTTTAAC ACCTTCCATA CTAAACTTCA AGCATAATTT TTGCGTTACT TATTATGTAT GGACCTTAAA
AAACAGTGCC TATGTCTCAG TCTATCTGAG CGTTCTAGGT TTTCTGAAGG AGAGATTCAG ACCTTCATGT CTGTTGATTC
TGACCGCACA ATAAACTTAT GTAACAGCCT TCATGATGCT TGGAGGTATC CTTTTTCTTT ATCTAATGTT TGCCTATTAA
GGAATTGACT CGTGCCACAT TATTTGATGA GTTGTGTGGT TTGGCATCTT CTTAGCTTGC CATTGCAGAT AGGAGTTGCT
CTCTATCTAT TGTATACTCA AGTGAACTAT GCATTTTTAT CTGGATTGGC AATAACAGTC ATACTAATGC CAGGTACTGC
TTGATTTTCC ATGGTTCTTC TGTATATTTC AAGAGGTTTG CCAGGTCATG CATTGCAACT TTATGCACAT ATCATTCTTT
GGTCCCTTGC TTCATTCATC TCTTTTGTTT GCAATACATT AGGGGTACAT GATCCTATGC TAAATGAAAT ACATGTATGT
ATGAATATTA AAGCTACTCT GGTTACTTTT TAGTACACGA ATTATGGTAC TCCTTGATAT AATCAATAGT TCAAGATTAT
GCTCATTTTT TATTCAGAAT ATTATTCTAA GTTCCTAACA TATCCGTATT TTCTTGTCCT TTTCTTGTAA CCAATGCTGT
ACATGCACAG TGAACAAATG GATCTCTACA AGAATAGCTC ACGCGACAGA AAAGATGATG AAACATAAAG ATGAGAGGTG
AGACCAAAAA TCCGTCTAAG TTTGTTTTTG GGGAGCTTAT CTGTTATGTT GCAGTGTTCT CTTCTTTCTA TTGGCATATC
ACGATGAGAT ATATATACTC ACAAATTATT GTAAGAAAAT GAAAAATAAG AATAGAATCA CGAAATTTGA TGGATTTATG
CAATACTGAC TAATTAGGCA CAATCGATAT TTTTCCATGA ACAGGATAAG TTGTGCAGGA GAACTGTTAG CACATATTAG
AACAGTGAAG ATGTACAGCT GGGAGAGATT ATTCACTCAA CGTTTGGTGG AAAGAAGAGA ATTAGAAGTG AAGCATCTTG
CGGTGTGCAA CTTCTCATTA TCAATTTTCC TTTAATTAGT TACATTTATA TGTGAAACTC ACAAGTGTCT CCTCTTTCCT
AATAAGACTC GCAAATATCT GGACGCTTGG TGTGTCTATT TCTGGGCAAC CACACCAACA TTGTTCTCTC TTTTCACCTT
TTCCATATTT GCTATAATGG GCCACTCGCT GGATGCTGCC ACGGTAAAAC AATATCCTGA TGATATGTTT GGACACATGC
AATCAGGGTA ACAAATCATT CTGATACATG TATTCCTTCT TACAGGTCTT CACTTGTGTT GCACTGTTCA ACACATTGAT
ACCACCATTA AACTCATTCC CATGGGTTAT TAATGGAATG ATTGATGTAA GTCGGACAGC CAATTTCTGT CATTACTATG
CTAGTGCTAA CTGTAACACT GGCAACACTG CTAACCATAT CTGTATCCTT TGGTGTTATT GTAGGCTGTT ATCTCTAGCA
GAAGGTTGAG CAAGTACTTA TCCAGTCCAG AGAAGCGTTC TTCTGCAATA CCTGTCTCAG CTGATCTTTT AAAGCATTGC
AATACTGAAA CAAATGTCAA TGCCATGGCT GTCATTCTTC GTAACGTTTG TTGCTCTTGG TCTAGCAGTT CTATTGTTGA
ATCGAGCATG ATTTTGAGAG ACGTATCTCT GGAGCTACAG AAAGGAATTT TTGTTGCAAT CATAGGAGAG GTATATTATT
TTAACTGATG TAGATAATAT TTTATTTTTC CTGCTAGAGT GCATTTTTTA TGGACATAAA TAGCGTTTTT CTTTCAGTTG
GTGAAACTGA ATATCTCTTG GATAACACAT CACTGGCAGA AAATTATATT TGAATTTGCT GCTATACCAC CAGTAAACTT
TCTTAAGTGT CCAAGGCCCG TGTTCTTCTC TCCACTTTTG CTGCCTCTTT ACTATTCTTC TAATACCATT CCATGAGCTT
AACTTCATCA ATGTCGCGAA ACATTTACAA CCTCGAGTTT TAGGCACCTT AGTTTTGCAT AAGGGATAGA AATAAACTCT
CTTTTGTAAA TACTTGTCAG TGGCCACTGC AGTTCTCAGT TAATTGAGGA ATTACATTAT GCCCACTTGC AGGTTGGTTG
TGGCAAATCA TCTTTGCTGA ACTCTATCAT CGGAGAAATT CATGTTACCA GTGGTTCCAT TACCTCCTAT GGTTCAATTG
CATATGTACC ACAGGTTGTA CTTCTTGATT TAGAAATTTC TTCAGTTTTG TAGTTCAACT TGGTAAAGCA TGTCGCGGAT
GTTGTGCAGG TGCCTTGGAT ACTGTCTGGT TCATTGCGAG ATAATATTTT GCTTGGAGAA GAATTTGATC CAAGGAGGTA
CCTTTACTCG TTTTGATCAC TTTGTTTTGT TAAGGTTATG TTTTCCAAAA CCTGAAACGA CCGTCGACCG GTGTTTATTG
TTTTGCATTT TTAATCAGTA TTGCGTGTCA ATGTTCATAC AGGTACGAAG AAGTGATACA TGCTTGTACC CTTGATGTTG
ATATCTCAGC AATGGTTGGG GGAGATATGT CACATATTGG AGAGAAAGGT CTTAACTTAT CTGGTGGACA AAGAGCCCGT
TTAGCCTTAG CAAGGTCAGA TTTTTTTTTT AAAGGAATTA GCAAGGTTAT ATGTTAACAA TGTTGTGCAA TTGACATGGG
AAAGTCCAAA AGTATGTTCT AACGCTATGA TCTTTACCCT TGCAGGGCTT TGTATCATGA CTCTGATGTT TACTTGTTTG
ACGATGTACT TAGTTCAGTT GACTCACAAG TTGCTTCGTA TATCTTGGAA AAAGCCATTA TGGGGCCCAA AATGAAGAGA
AAAACACGAA TATTAAGCAC CCACAATCTT CAGGTAATAT TTATTTAATC ACGCCCAAAC AAAGTTAGGT CCATCAAAAG
AACAACACCA TTCCCTTGTT CTTCAGGCAA TTTCCGCAGC AGATATGATA GTGGTCATGG CTAATGGGCT TGTTAAGTGG
TTTGGGACGT TGGACTCTTT CTTAGCAACT CCATACTCGA CACTGTCTAA GCCAGAGAGT TCAAGGGTTA TCTCATCAAC
ATTTTCTGAG AAAAACAAAG GAGTGAGCGT CGCCCATGAA TCCGAGACTA ATGGCCTGAT TGACAATGAC TCAGTAGTTG
ATCACGAGGA ACAAAGAGAG CAGAATTCTG TAGAGGCCAG GAAAGAAGGC ATGGTAGAGC TTAGTGTGTA CAAGTGA