Os06t0184900-01

Locus

Os06g0184900

Description

Transferase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HCT3

CGSNL Gene Name

HYDROXYCINNAMOYLTRANSFERASE 3

Oryzabase Gene Symbol Synonym(s)

OsHCT3, Os-PHT1, OsPHT1, PHT1

Oryzabase Gene Name Synonym(s)

Hydroxycinnamoyltransferase 3, putrescine hy- droxycinnamoyl transferase 1

Transcript Evidence

AK109842 (DDBJ, Best hit)

Protein Evidence

A2YA28 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Full-length cDNA

002-148-E02 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0184900-01)

RiceXPro (AK109842)

Others

Oryzabase (10358)

KEGG (Os06t0184900-01)

Transcript

1499 bp

>Os06t0184900-01 Transferase family protein.
GCAAAACACGTGACAAGTAGAGTGGAGTAGTAGAGAAAAGCATCTTCTCGCATCCATGGC
AGTGGAGATCGTCAAGTCCTCCATGgtgacggccggcgaggcgacgccggagcacaggat
atggctctccaacctcgacctgctggtggccaggagccacacccccaccgtctacgtcta
ccggcgaactggccccgactccgacgcggcgtttttctcgccggacgtcctcaaggccgc
cctgtccaaggtgctcgtccccttctaccccctcgccggccgcctcgctcaggacagcgc
cggcaggccggagatcagctgcaccggcgagggcgtgctcttcgtCACGGCGCGGAGTGG
CGCCACCATTGACGACCTGGGCGACCTCGCCCCGTCGGACGAGCTCCGGCGGATGCTTGT
CCCGGCGGCCGATGTCGCCGCTGCCAGCATCTTGGCCATGTTCCAGGTGACGTTCTTTAG
GTGTGGAGGGGTGTGCCTGGGCGCGGCGATCCATCACACGGCGGCGGACGGCCTCGCGGC
GCTGGACTTCGTCAACACGTGGGCCGCCATTGCGAGGGACGTCGCCGGCGACGGCGAGGC
GGCGGCGGCGGCGGTGCAGCGGCCGTGGCTCGACCGCACGCTCCTCCGCGCGCGCTCCCC
TCCCGCCGTGCGCTTCGACCACGCCGAGTACTCCCGTCGCCGCGGCGGCGGTTCAAAGCT
GCCGTTCGACTCGGCCATCCTCCCCATGTCCAAGAACCAGCTCAACGCGCTCAAGGGCGC
CGGCGCCGGCGCCGGCAAGAGGCTGTCCACTTTTACGGCGGTGGTCGCGCACGTGTGGCG
GTGCGCGTGCAAGGCGCGCGGGCTCGCCGTCGCCGGAACGGAGGCGGCGACGAGGCTGTA
CATGACCGCCGACGCGCGCACCCGCCTGCACCCGCCGCTCCCGCGCGGCTACCTCGGCAA
CGCCATCTTCCGCGCGTCGGCGGTGTCCAAGGTGAGCGACATCGTCGCCGCCGGGCCGCT
CGGCGCCGTCGCGGAGAAGGTGTCCGCCGCCACCGCGCGGCTCGACGACGGCTACGTCCG
GTCGCTGCTGGACCACCTGGAGCAGACGGCGGCGGCGGCGAGCGGCGGCGCGGCGGGGCT
CCGCAAGGGGGAGTGGGTGATGCCGGAGAGTGACCTGTGGGTGATCAGCTGGCAGGGGCT
GCCGCTCTACGACGCCGACTTCGGCTGGGGGCGGCCGGCGTTCATGGGGCGTGCGTGCCT
CCAGTTCAGCGGCCTCGTCTACCTCGTGCCAGGCCGAGACGACGGCGACGGCCGGCTCGA
CGTCGTCGTGGCCATGGACCCCGAGAGCCTTGCCAAGTTCAAGGATGTGTTCTATGAGGA
GCTCAAGTGTTAGCTCCATTCGAGCTCAACACCAACTTTTTTTTTAATTAAGCCGAATTT
ATAACGATTTTGTTAAAAATATATTGATTTTTCCCGAAAAAAAAATATTGATTTCTGTC

CDS

1338 bp

>Os06t0184900-01 Transferase family protein.
ATGGCAGTGGAGATCGTCAAGTCCTCCATGgtgacggccggcgaggcgacgccggagcac
aggatatggctctccaacctcgacctgctggtggccaggagccacacccccaccgtctac
gtctaccggcgaactggccccgactccgacgcggcgtttttctcgccggacgtcctcaag
gccgccctgtccaaggtgctcgtccccttctaccccctcgccggccgcctcgctcaggac
agcgccggcaggccggagatcagctgcaccggcgagggcgtgctcttcgtCACGGCGCGG
AGTGGCGCCACCATTGACGACCTGGGCGACCTCGCCCCGTCGGACGAGCTCCGGCGGATG
CTTGTCCCGGCGGCCGATGTCGCCGCTGCCAGCATCTTGGCCATGTTCCAGGTGACGTTC
TTTAGGTGTGGAGGGGTGTGCCTGGGCGCGGCGATCCATCACACGGCGGCGGACGGCCTC
GCGGCGCTGGACTTCGTCAACACGTGGGCCGCCATTGCGAGGGACGTCGCCGGCGACGGC
GAGGCGGCGGCGGCGGCGGTGCAGCGGCCGTGGCTCGACCGCACGCTCCTCCGCGCGCGC
TCCCCTCCCGCCGTGCGCTTCGACCACGCCGAGTACTCCCGTCGCCGCGGCGGCGGTTCA
AAGCTGCCGTTCGACTCGGCCATCCTCCCCATGTCCAAGAACCAGCTCAACGCGCTCAAG
GGCGCCGGCGCCGGCGCCGGCAAGAGGCTGTCCACTTTTACGGCGGTGGTCGCGCACGTG
TGGCGGTGCGCGTGCAAGGCGCGCGGGCTCGCCGTCGCCGGAACGGAGGCGGCGACGAGG
CTGTACATGACCGCCGACGCGCGCACCCGCCTGCACCCGCCGCTCCCGCGCGGCTACCTC
GGCAACGCCATCTTCCGCGCGTCGGCGGTGTCCAAGGTGAGCGACATCGTCGCCGCCGGG
CCGCTCGGCGCCGTCGCGGAGAAGGTGTCCGCCGCCACCGCGCGGCTCGACGACGGCTAC
GTCCGGTCGCTGCTGGACCACCTGGAGCAGACGGCGGCGGCGGCGAGCGGCGGCGCGGCG
GGGCTCCGCAAGGGGGAGTGGGTGATGCCGGAGAGTGACCTGTGGGTGATCAGCTGGCAG
GGGCTGCCGCTCTACGACGCCGACTTCGGCTGGGGGCGGCCGGCGTTCATGGGGCGTGCG
TGCCTCCAGTTCAGCGGCCTCGTCTACCTCGTGCCAGGCCGAGACGACGGCGACGGCCGG
CTCGACGTCGTCGTGGCCATGGACCCCGAGAGCCTTGCCAAGTTCAAGGATGTGTTCTAT
GAGGAGCTCAAGTGTTAG

Protein

446 aa

>Os06t0184900-01 Transferase family protein.
MAVEIVKSSMVTAGEATPEHRIWLSNLDLLVARSHTPTVYVYRRTGPDSDAAFFSPDVLK
AALSKVLVPFYPLAGRLAQDSAGRPEISCTGEGVLFVTARSGATIDDLGDLAPSDELRRM
LVPAADVAAASILAMFQVTFFRCGGVCLGAAIHHTAADGLAALDFVNTWAAIARDVAGDG
EAAAAAVQRPWLDRTLLRARSPPAVRFDHAEYSRRRGGGSKLPFDSAILPMSKNQLNALK
GAGAGAGKRLSTFTAVVAHVWRCACKARGLAVAGTEAATRLYMTADARTRLHPPLPRGYL
GNAIFRASAVSKVSDIVAAGPLGAVAEKVSAATARLDDGYVRSLLDHLEQTAAAASGGAA
GLRKGEWVMPESDLWVISWQGLPLYDADFGWGRPAFMGRACLQFSGLVYLVPGRDDGDGR
LDVVVAMDPESLAKFKDVFYEELKC*

5'UTR

chr06:4269116..4269170 (+ strand) : 55 bp

CDS

chr06:4269171..4270508 (+ strand) : 1338 bp

3'UTR

chr06:4270509..4270614 (+ strand) : 106 bp

FASTA

>Os06t0184900-01 class=Sequence position=chr06:4269116..4270614 (+ strand)
GCAAAACACG TGACAAGTAG AGTGGAGTAG TAGAGAAAAG CATCTTCTCG CATCCATGGC AGTGGAGATC GTCAAGTCCT
CCATGgtgac ggccggcgag gcgacgccgg agcacaggat atggctctcc aacctcgacc tgctggtggc caggagccac
acccccaccg tctacgtcta ccggcgaact ggccccgact ccgacgcggc gtttttctcg ccggacgtcc tcaaggccgc
cctgtccaag gtgctcgtcc ccttctaccc cctcgccggc cgcctcgctc aggacagcgc cggcaggccg gagatcagct
gcaccggcga gggcgtgctc ttcgtCACGG CGCGGAGTGG CGCCACCATT GACGACCTGG GCGACCTCGC CCCGTCGGAC
GAGCTCCGGC GGATGCTTGT CCCGGCGGCC GATGTCGCCG CTGCCAGCAT CTTGGCCATG TTCCAGGTGA CGTTCTTTAG
GTGTGGAGGG GTGTGCCTGG GCGCGGCGAT CCATCACACG GCGGCGGACG GCCTCGCGGC GCTGGACTTC GTCAACACGT
GGGCCGCCAT TGCGAGGGAC GTCGCCGGCG ACGGCGAGGC GGCGGCGGCG GCGGTGCAGC GGCCGTGGCT CGACCGCACG
CTCCTCCGCG CGCGCTCCCC TCCCGCCGTG CGCTTCGACC ACGCCGAGTA CTCCCGTCGC CGCGGCGGCG GTTCAAAGCT
GCCGTTCGAC TCGGCCATCC TCCCCATGTC CAAGAACCAG CTCAACGCGC TCAAGGGCGC CGGCGCCGGC GCCGGCAAGA
GGCTGTCCAC TTTTACGGCG GTGGTCGCGC ACGTGTGGCG GTGCGCGTGC AAGGCGCGCG GGCTCGCCGT CGCCGGAACG
GAGGCGGCGA CGAGGCTGTA CATGACCGCC GACGCGCGCA CCCGCCTGCA CCCGCCGCTC CCGCGCGGCT ACCTCGGCAA
CGCCATCTTC CGCGCGTCGG CGGTGTCCAA GGTGAGCGAC ATCGTCGCCG CCGGGCCGCT CGGCGCCGTC GCGGAGAAGG
TGTCCGCCGC CACCGCGCGG CTCGACGACG GCTACGTCCG GTCGCTGCTG GACCACCTGG AGCAGACGGC GGCGGCGGCG
AGCGGCGGCG CGGCGGGGCT CCGCAAGGGG GAGTGGGTGA TGCCGGAGAG TGACCTGTGG GTGATCAGCT GGCAGGGGCT
GCCGCTCTAC GACGCCGACT TCGGCTGGGG GCGGCCGGCG TTCATGGGGC GTGCGTGCCT CCAGTTCAGC GGCCTCGTCT
ACCTCGTGCC AGGCCGAGAC GACGGCGACG GCCGGCTCGA CGTCGTCGTG GCCATGGACC CCGAGAGCCT TGCCAAGTTC
AAGGATGTGT TCTATGAGGA GCTCAAGTGT TAGCTCCATT CGAGCTCAAC ACCAACTTTT TTTTTAATTA AGCCGAATTT
ATAACGATTT TGTTAAAAAT ATATTGATTT TTCCCGAAAA AAAAATATTG ATTTCTGTC

Locus: Os06g0184900

Loading...

Locus: Os06g0184900

Loading...