Os06t0185500-00

Locus

Os06g0185500

Description

Transferase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HCT4

CGSNL Gene Name

HYDROXYCINNAMOYLTRANSFERASE 4

Oryzabase Gene Symbol Synonym(s)

OsHCT4

Oryzabase Gene Name Synonym(s)

Hydroxycinnamoyltransferase 4

Transcript Evidence

AK332885 (DDBJ)

Protein Evidence

NP_001057003.1 (RefSeq)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Expression Databases

TENOR (Os06t0185500-00)

Others

Oryzabase (10359)

Transcript

1363 bp

>Os06t0185500-00 Transferase family protein.
CACACGCAGAAACCTGCACTACCATCTCACCACTGATCAGTAGCTAGCTCGTGAAGAagc
catggcgacggtggacgtgctgacgtcggaggtggtcgtccccgCCGGCGAGACGCCGGC
GGGCGCCGTCTGGCTGTCCAACCTCGACCTCGCCGCGCGCCGCGGCTACACGCCGACGGT
GTTCTTCTACCGCCACAACGGCGAGCCGGGGTTCTTCGCGGCCGACGCCATGAGGGACAG
CCtcgccagggcgctcgtggcgttctacccggtcgccggccgcctcgggctcgacggcga
cggccgcgtccaggtcgactgcaccggcgagggcgtggtgttcgccacggcgaggtccgg
gcactacgcgctcgacgacctgatgggcgagttcgtgccgtgcgacgagatgcgcgacct
gttcgtgcccgcggcgccggcggcggcgagctgctgcccgcgcggcggcgcgctgctgct
ggtgcaggtcacgtacctgcggtgcggcggcgtcgtgctcggcatggcgctgcaccactc
catcgccgacggGCGGAGCGCGGCGCACTTCGTGGAGACGTGGGCGAGCATCGCGCGCGG
CGCGCCCGCCGCGGACGCGCCCGTGCCGCCATGCTTCGACCACAGGCTGCTCGCCGCGCG
GCCGGCGCGCGCGGTGCTGTACGACCACCCGGAGTACAAGCCCGAGCCGGCGCCGCCGGC
GCGCGCCGCCACGGCGTCCACGTACGCGAGCGCCATCATCACGCTGACGAAGCAGCAGGT
CGGCGCGCTGAGGGCGGCGTGCGCGGGGGCGTCGACGTTCCGCGCGGTGGTGGCGCTGGT
GTGGCAGTGCGCGTGCCGCGCGCGGGCGCTGCCGCCGGAGGCGGAGACGAGGCTCCACTC
CATGATCGACACGCGGCAGCGCCTGTCGCCGCCGCTGCCGCCGGGGTACTTCGGCAACGC
GGTGATCCGCACGTCGACGGCGGCGACGGCCGGGGAGGTGGTGTCGAGCCCCGTGGGGCA
CGCGGCGCGGCGGGCGCGCGCGGCGACGAGCCAGGGCGAGGACTACGCGCGGTCGGTGGT
GGACTACCTGGAGGGCGTGGACGCCATGAACCTGCCGAGGAGCGGCGTCTCGCGGGCGGA
CCTCCGCGCCATCAGCTGGCTGGGCATGTCGCTCGCCGACGCCGACTTCGGGTGGGGCTC
GCCGGCGTTCATGGGTCCGGCGATCATGTACTACAGCGGGTTCGTGTACGTGATGAACGC
GCCGGGGAAGGACGGCGCCGTCGCGCTGGCGCTGTCGCTGGAGCCGGAGAGCATGCCGGA
GTTCAGGAAGGTGTTCGCCGACGAGGTGGCGCGATTGGCATGA

CDS

1302 bp

>Os06t0185500-00 Transferase family protein.
atggcgacggtggacgtgctgacgtcggaggtggtcgtccccgCCGGCGAGACGCCGGCG
GGCGCCGTCTGGCTGTCCAACCTCGACCTCGCCGCGCGCCGCGGCTACACGCCGACGGTG
TTCTTCTACCGCCACAACGGCGAGCCGGGGTTCTTCGCGGCCGACGCCATGAGGGACAGC
Ctcgccagggcgctcgtggcgttctacccggtcgccggccgcctcgggctcgacggcgac
ggccgcgtccaggtcgactgcaccggcgagggcgtggtgttcgccacggcgaggtccggg
cactacgcgctcgacgacctgatgggcgagttcgtgccgtgcgacgagatgcgcgacctg
ttcgtgcccgcggcgccggcggcggcgagctgctgcccgcgcggcggcgcgctgctgctg
gtgcaggtcacgtacctgcggtgcggcggcgtcgtgctcggcatggcgctgcaccactcc
atcgccgacggGCGGAGCGCGGCGCACTTCGTGGAGACGTGGGCGAGCATCGCGCGCGGC
GCGCCCGCCGCGGACGCGCCCGTGCCGCCATGCTTCGACCACAGGCTGCTCGCCGCGCGG
CCGGCGCGCGCGGTGCTGTACGACCACCCGGAGTACAAGCCCGAGCCGGCGCCGCCGGCG
CGCGCCGCCACGGCGTCCACGTACGCGAGCGCCATCATCACGCTGACGAAGCAGCAGGTC
GGCGCGCTGAGGGCGGCGTGCGCGGGGGCGTCGACGTTCCGCGCGGTGGTGGCGCTGGTG
TGGCAGTGCGCGTGCCGCGCGCGGGCGCTGCCGCCGGAGGCGGAGACGAGGCTCCACTCC
ATGATCGACACGCGGCAGCGCCTGTCGCCGCCGCTGCCGCCGGGGTACTTCGGCAACGCG
GTGATCCGCACGTCGACGGCGGCGACGGCCGGGGAGGTGGTGTCGAGCCCCGTGGGGCAC
GCGGCGCGGCGGGCGCGCGCGGCGACGAGCCAGGGCGAGGACTACGCGCGGTCGGTGGTG
GACTACCTGGAGGGCGTGGACGCCATGAACCTGCCGAGGAGCGGCGTCTCGCGGGCGGAC
CTCCGCGCCATCAGCTGGCTGGGCATGTCGCTCGCCGACGCCGACTTCGGGTGGGGCTCG
CCGGCGTTCATGGGTCCGGCGATCATGTACTACAGCGGGTTCGTGTACGTGATGAACGCG
CCGGGGAAGGACGGCGCCGTCGCGCTGGCGCTGTCGCTGGAGCCGGAGAGCATGCCGGAG
TTCAGGAAGGTGTTCGCCGACGAGGTGGCGCGATTGGCATGA

Protein

434 aa

>Os06t0185500-00 Transferase family protein.
MATVDVLTSEVVVPAGETPAGAVWLSNLDLAARRGYTPTVFFYRHNGEPGFFAADAMRDS
LARALVAFYPVAGRLGLDGDGRVQVDCTGEGVVFATARSGHYALDDLMGEFVPCDEMRDL
FVPAAPAAASCCPRGGALLLVQVTYLRCGGVVLGMALHHSIADGRSAAHFVETWASIARG
APAADAPVPPCFDHRLLAARPARAVLYDHPEYKPEPAPPARAATASTYASAIITLTKQQV
GALRAACAGASTFRAVVALVWQCACRARALPPEAETRLHSMIDTRQRLSPPLPPGYFGNA
VIRTSTAATAGEVVSSPVGHAARRARAATSQGEDYARSVVDYLEGVDAMNLPRSGVSRAD
LRAISWLGMSLADADFGWGSPAFMGPAIMYYSGFVYVMNAPGKDGAVALALSLEPESMPE
FRKVFADEVARLA*

5'UTR

chr06:4303077..4303137 (- strand) : 61 bp

CDS

chr06:4301775..4303076 (- strand) : 1302 bp

FASTA

>Os06t0185500-00 class=Sequence position=chr06:4301775..4303137 (- strand)
CACACGCAGA AACCTGCACT ACCATCTCAC CACTGATCAG TAGCTAGCTC GTGAAGAagc catggcgacg gtggacgtgc
tgacgtcgga ggtggtcgtc cccgCCGGCG AGACGCCGGC GGGCGCCGTC TGGCTGTCCA ACCTCGACCT CGCCGCGCGC
CGCGGCTACA CGCCGACGGT GTTCTTCTAC CGCCACAACG GCGAGCCGGG GTTCTTCGCG GCCGACGCCA TGAGGGACAG
CCtcgccagg gcgctcgtgg cgttctaccc ggtcgccggc cgcctcgggc tcgacggcga cggccgcgtc caggtcgact
gcaccggcga gggcgtggtg ttcgccacgg cgaggtccgg gcactacgcg ctcgacgacc tgatgggcga gttcgtgccg
tgcgacgaga tgcgcgacct gttcgtgccc gcggcgccgg cggcggcgag ctgctgcccg cgcggcggcg cgctgctgct
ggtgcaggtc acgtacctgc ggtgcggcgg cgtcgtgctc ggcatggcgc tgcaccactc catcgccgac ggGCGGAGCG
CGGCGCACTT CGTGGAGACG TGGGCGAGCA TCGCGCGCGG CGCGCCCGCC GCGGACGCGC CCGTGCCGCC ATGCTTCGAC
CACAGGCTGC TCGCCGCGCG GCCGGCGCGC GCGGTGCTGT ACGACCACCC GGAGTACAAG CCCGAGCCGG CGCCGCCGGC
GCGCGCCGCC ACGGCGTCCA CGTACGCGAG CGCCATCATC ACGCTGACGA AGCAGCAGGT CGGCGCGCTG AGGGCGGCGT
GCGCGGGGGC GTCGACGTTC CGCGCGGTGG TGGCGCTGGT GTGGCAGTGC GCGTGCCGCG CGCGGGCGCT GCCGCCGGAG
GCGGAGACGA GGCTCCACTC CATGATCGAC ACGCGGCAGC GCCTGTCGCC GCCGCTGCCG CCGGGGTACT TCGGCAACGC
GGTGATCCGC ACGTCGACGG CGGCGACGGC CGGGGAGGTG GTGTCGAGCC CCGTGGGGCA CGCGGCGCGG CGGGCGCGCG
CGGCGACGAG CCAGGGCGAG GACTACGCGC GGTCGGTGGT GGACTACCTG GAGGGCGTGG ACGCCATGAA CCTGCCGAGG
AGCGGCGTCT CGCGGGCGGA CCTCCGCGCC ATCAGCTGGC TGGGCATGTC GCTCGCCGAC GCCGACTTCG GGTGGGGCTC
GCCGGCGTTC ATGGGTCCGG CGATCATGTA CTACAGCGGG TTCGTGTACG TGATGAACGC GCCGGGGAAG GACGGCGCCG
TCGCGCTGGC GCTGTCGCTG GAGCCGGAGA GCATGCCGGA GTTCAGGAAG GTGTTCGCCG ACGAGGTGGC GCGATTGGCA
TGA

Locus: Os06g0185500

Loading...

Locus: Os06g0185500

Loading...