Os06t0193200-01

Locus

Os06g0193200

Description

Similar to Pectin methylesterase 8 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PME19

CGSNL Gene Name

PECTIN METHYLESTERASE 19

Oryzabase Gene Symbol Synonym(s)

OsPME19

Oryzabase Gene Name Synonym(s)

pectin methylesterase 19

Transcript Evidence

AK287720 (DDBJ, Best hit)

Protein Evidence

B9RR23 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: cell wall modification (GO:0042545)

Cellular Component: cell wall (GO:0005618)

Molecular Function: enzyme inhibitor activity (GO:0004857)

Molecular Function: pectinesterase activity (GO:0030599)

Functional domain (InterPro)

Pectinesterase, catalytic (IPR000070)

Pectinesterase inhibitor (IPR006501)

Pectin lyase fold/virulence factor (IPR011050)

Pectin lyase fold (IPR012334)

Full-length cDNA

J065136H22 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0193200-01)

Others

Oryzabase (13183)

KEGG (Os06t0193200-01)

Transcript

1894 bp

>Os06t0193200-01 Similar to Pectin methylesterase 8 (Fragment).
TCAAGCTCACTCTCAGTCGAGTACTCGAGCTAGCTTAGCCATGGCGGCGATCTCGCCACG
TCTGGTTGTGTTCGTCGCCGTCCTCCTCCTCCTCCTCCTCGCCACGGCGACCACCACGCA
ATGCCACCGTCACGGCAAGCGACACCGCCACCACGCCGTCGCCGCCAAGGGCGCCGCGGC
GGCGGCGGCCACGCCGGGGGTGACAGACGTCCATGCCGTCTGCCGCACGACGCCGCACCA
GGACTCCTGCCTCGCGTCGACGGCCGCGCACCTCGACGCCGTCTCCGCGGAGGTGGTGGC
AGCGGCGTCGGCCATCTCGGTGCAGCTGCTCCCGCCGAACATCCTGTCCGTCGCGCTCGC
GTCGCTCCGGGGCGCGCTCGCCGCCGTGTCGTCGCTCTCCCCGGCGCTCTCCTCCGCGCT
CTCGCCGCCGTCGTCGGGCGCGTCCCCGCTCCGGCGCGGCGCGGCGCAGGACTGCCTCGA
GCTCCACGCCGCCACGCTCGCCTCCCTGTCGCGGTCCGCCTCGCTGCTCGCGTCCCCCGG
CGAGGGCCTCCCCGCCGTGCGCGCCCACCTCGCGGCGGCGCTCGCCAACAAGGCCACCTG
CCTCGACGGGCTCGACGGCGCCGCGCCGTCGTCCGGCCTCCTCGCGTCCCTCGACGACGC
CTACGCCCACGTCACCAACTCCCTCTCCCTCGTCGCCGGCCGCCGCGGCGGGGGCGGATC
GGCGGCGAGCTTCGCCGCCGCCGTCGCCAACATCATCCACCACAACCGCCGCCTCCTCGA
CGACGACGACAACGACGACTACAACGGCGGGAACGACGACGACGACAACAGCAACAACTC
CGGCGAGAACACGGTGGTGATCACGGTGGCGAAGGACGGGAGCGGGAACTACCGGACGGT
GGGGGAGGCGGTGGCGGCGGCGCCGAACAACAGCGCGGCGAGGACGGTGATCCGAGTGAG
GGCCGGGACGTACGAGGAGAACGTGGAGGTGCCACCGTACAAGACGAACATCGCCCTCGT
CGGCGACGGCCGCGGCGCCACCGTCATCACCGGCAGCCGCAGCGCCGCCGACGGCTGGAC
CACCTTCCGCTCCGCCACCTTCGGGGTGTCAGGCGAAGGGTTCATGGCTCGGGACGTGAC
GTTCCGGAACACGGCGGGGGCGGCGAAGGGGCAGGCGGTGGCGCTGCGGGTGAGCGCGGA
CATGGCGGCGGCGTACCGGTGCGGCGTCGAGGGCCACCAGGACTCTCTCTACGCGCACTC
GTTCCGCCAGTTCTACCGCGAGTGCGCCGTCTCCGGCACCGTCGACCTCGTCTTCGGcga
cgccgccgccgtcctccaggcgtgcgagctcgtcgccggcgcccccgtcgccggccagtc
caacgtcctcacggcgcaggcgcgcggcgaccccaacgaggacacgggcttctccgtgca
caactgcacggtggtcgcctcgccggagctcctcgccagcggcgtcagcacgcgcacctt
cctgggccggccgtggcggccctacgcccgcgccgtcgtcatggactcctacctcggccc
gctcgtcgaccgggccggctgggtcgagtggcccggcgccgagcccggccgcgccgagAC
GGTGTACTTCGGTGAGTATGGGAATGGCGGGCCGGGCGCCGCCATGGACGGCCGCGTCGG
ATGGGCCGGGTTCCATGATATGGGCTACGACGAGGCGGCCCAGTTCTCCGTCGACAACCT
CATCTCCGGCGACCAGTGGCTCGCCGCCACCTCCTTCCCCTACGACGACGACGTCTAACC
GTACGAGCATTGTCACCGACGAAATCCATGTCCAATCAATGCATTGTAGTATTGCACTAT
TACTACACCTGTATTAATGAATTATTACCACGCG

CDS

1758 bp

>Os06t0193200-01 Similar to Pectin methylesterase 8 (Fragment).
ATGGCGGCGATCTCGCCACGTCTGGTTGTGTTCGTCGCCGTCCTCCTCCTCCTCCTCCTC
GCCACGGCGACCACCACGCAATGCCACCGTCACGGCAAGCGACACCGCCACCACGCCGTC
GCCGCCAAGGGCGCCGCGGCGGCGGCGGCCACGCCGGGGGTGACAGACGTCCATGCCGTC
TGCCGCACGACGCCGCACCAGGACTCCTGCCTCGCGTCGACGGCCGCGCACCTCGACGCC
GTCTCCGCGGAGGTGGTGGCAGCGGCGTCGGCCATCTCGGTGCAGCTGCTCCCGCCGAAC
ATCCTGTCCGTCGCGCTCGCGTCGCTCCGGGGCGCGCTCGCCGCCGTGTCGTCGCTCTCC
CCGGCGCTCTCCTCCGCGCTCTCGCCGCCGTCGTCGGGCGCGTCCCCGCTCCGGCGCGGC
GCGGCGCAGGACTGCCTCGAGCTCCACGCCGCCACGCTCGCCTCCCTGTCGCGGTCCGCC
TCGCTGCTCGCGTCCCCCGGCGAGGGCCTCCCCGCCGTGCGCGCCCACCTCGCGGCGGCG
CTCGCCAACAAGGCCACCTGCCTCGACGGGCTCGACGGCGCCGCGCCGTCGTCCGGCCTC
CTCGCGTCCCTCGACGACGCCTACGCCCACGTCACCAACTCCCTCTCCCTCGTCGCCGGC
CGCCGCGGCGGGGGCGGATCGGCGGCGAGCTTCGCCGCCGCCGTCGCCAACATCATCCAC
CACAACCGCCGCCTCCTCGACGACGACGACAACGACGACTACAACGGCGGGAACGACGAC
GACGACAACAGCAACAACTCCGGCGAGAACACGGTGGTGATCACGGTGGCGAAGGACGGG
AGCGGGAACTACCGGACGGTGGGGGAGGCGGTGGCGGCGGCGCCGAACAACAGCGCGGCG
AGGACGGTGATCCGAGTGAGGGCCGGGACGTACGAGGAGAACGTGGAGGTGCCACCGTAC
AAGACGAACATCGCCCTCGTCGGCGACGGCCGCGGCGCCACCGTCATCACCGGCAGCCGC
AGCGCCGCCGACGGCTGGACCACCTTCCGCTCCGCCACCTTCGGGGTGTCAGGCGAAGGG
TTCATGGCTCGGGACGTGACGTTCCGGAACACGGCGGGGGCGGCGAAGGGGCAGGCGGTG
GCGCTGCGGGTGAGCGCGGACATGGCGGCGGCGTACCGGTGCGGCGTCGAGGGCCACCAG
GACTCTCTCTACGCGCACTCGTTCCGCCAGTTCTACCGCGAGTGCGCCGTCTCCGGCACC
GTCGACCTCGTCTTCGGcgacgccgccgccgtcctccaggcgtgcgagctcgtcgccggc
gcccccgtcgccggccagtccaacgtcctcacggcgcaggcgcgcggcgaccccaacgag
gacacgggcttctccgtgcacaactgcacggtggtcgcctcgccggagctcctcgccagc
ggcgtcagcacgcgcaccttcctgggccggccgtggcggccctacgcccgcgccgtcgtc
atggactcctacctcggcccgctcgtcgaccgggccggctgggtcgagtggcccggcgcc
gagcccggccgcgccgagACGGTGTACTTCGGTGAGTATGGGAATGGCGGGCCGGGCGCC
GCCATGGACGGCCGCGTCGGATGGGCCGGGTTCCATGATATGGGCTACGACGAGGCGGCC
CAGTTCTCCGTCGACAACCTCATCTCCGGCGACCAGTGGCTCGCCGCCACCTCCTTCCCC
TACGACGACGACGTCTAA

Protein

586 aa

>Os06t0193200-01 Similar to Pectin methylesterase 8 (Fragment).
MAAISPRLVVFVAVLLLLLLATATTTQCHRHGKRHRHHAVAAKGAAAAAATPGVTDVHAV
CRTTPHQDSCLASTAAHLDAVSAEVVAAASAISVQLLPPNILSVALASLRGALAAVSSLS
PALSSALSPPSSGASPLRRGAAQDCLELHAATLASLSRSASLLASPGEGLPAVRAHLAAA
LANKATCLDGLDGAAPSSGLLASLDDAYAHVTNSLSLVAGRRGGGGSAASFAAAVANIIH
HNRRLLDDDDNDDYNGGNDDDDNSNNSGENTVVITVAKDGSGNYRTVGEAVAAAPNNSAA
RTVIRVRAGTYEENVEVPPYKTNIALVGDGRGATVITGSRSAADGWTTFRSATFGVSGEG
FMARDVTFRNTAGAAKGQAVALRVSADMAAAYRCGVEGHQDSLYAHSFRQFYRECAVSGT
VDLVFGDAAAVLQACELVAGAPVAGQSNVLTAQARGDPNEDTGFSVHNCTVVASPELLAS
GVSTRTFLGRPWRPYARAVVMDSYLGPLVDRAGWVEWPGAEPGRAETVYFGEYGNGGPGA
AMDGRVGWAGFHDMGYDEAAQFSVDNLISGDQWLAATSFPYDDDV*

5'UTR

chr06:4700512..4700551 (+ strand) : 40 bp

CDS

chr06:4700552..4701614 (+ strand) : 1063 bp

chr06:4702252..4702946 (+ strand) : 695 bp

3'UTR

chr06:4702947..4703042 (+ strand) : 96 bp

FASTA

>Os06t0193200-01 class=Sequence position=chr06:4700512..4703042 (+ strand)
TCAAGCTCAC TCTCAGTCGA GTACTCGAGC TAGCTTAGCC ATGGCGGCGA TCTCGCCACG TCTGGTTGTG TTCGTCGCCG
TCCTCCTCCT CCTCCTCCTC GCCACGGCGA CCACCACGCA ATGCCACCGT CACGGCAAGC GACACCGCCA CCACGCCGTC
GCCGCCAAGG GCGCCGCGGC GGCGGCGGCC ACGCCGGGGG TGACAGACGT CCATGCCGTC TGCCGCACGA CGCCGCACCA
GGACTCCTGC CTCGCGTCGA CGGCCGCGCA CCTCGACGCC GTCTCCGCGG AGGTGGTGGC AGCGGCGTCG GCCATCTCGG
TGCAGCTGCT CCCGCCGAAC ATCCTGTCCG TCGCGCTCGC GTCGCTCCGG GGCGCGCTCG CCGCCGTGTC GTCGCTCTCC
CCGGCGCTCT CCTCCGCGCT CTCGCCGCCG TCGTCGGGCG CGTCCCCGCT CCGGCGCGGC GCGGCGCAGG ACTGCCTCGA
GCTCCACGCC GCCACGCTCG CCTCCCTGTC GCGGTCCGCC TCGCTGCTCG CGTCCCCCGG CGAGGGCCTC CCCGCCGTGC
GCGCCCACCT CGCGGCGGCG CTCGCCAACA AGGCCACCTG CCTCGACGGG CTCGACGGCG CCGCGCCGTC GTCCGGCCTC
CTCGCGTCCC TCGACGACGC CTACGCCCAC GTCACCAACT CCCTCTCCCT CGTCGCCGGC CGCCGCGGCG GGGGCGGATC
GGCGGCGAGC TTCGCCGCCG CCGTCGCCAA CATCATCCAC CACAACCGCC GCCTCCTCGA CGACGACGAC AACGACGACT
ACAACGGCGG GAACGACGAC GACGACAACA GCAACAACTC CGGCGAGAAC ACGGTGGTGA TCACGGTGGC GAAGGACGGG
AGCGGGAACT ACCGGACGGT GGGGGAGGCG GTGGCGGCGG CGCCGAACAA CAGCGCGGCG AGGACGGTGA TCCGAGTGAG
GGCCGGGACG TACGAGGAGA ACGTGGAGGT GCCACCGTAC AAGACGAACA TCGCCCTCGT CGGCGACGGC CGCGGCGCCA
CCGTCATCAC CGGCAGCCGC AGCGCCGCCG ACGGCTGGAC CACCTTCCGC TCCGCCACCT TCGGTAAATG AAATCCCCCA
CACCTCGTAA ACAGCAAAGC ATCCCGTGAC ACAAAGCTAT CGCCTATCGG ATTGGGAACG TGCGATCCAT CCTGGCTCGC
TCTCTGCATG CATGCACGCG ACGATGCCTC ACGTGGGTCC CACTCCGCAG TGGGCGTGAC ACAAATATTT GGCCTACCGA
TCACGTGCAT GTTCTCACAC TGATGCAGCC GTTTGTATGT TACttaaaaa aaatcatcaa aaaattaaaa taatttagtt
acatgataaa taagtaggtt gaaattcaac ttatacgagt agaagaaata aattagattt tgaatagaac gtaggagtat
aatttatgct taaatttgtt atttttaatt atatacttgt atgtctgtaa aatgacatat ctcataaatt aatctatcct
actttttttt taaaaaaata atgacctttt aaatgccata caCAAAGGAC ACAAAAAAAA ATCTATCTAC AACTGACATG
ATCTCCATGG ATCTAAGCAT CTTTGAGCTT AGATATTTGC TGTCACTTGT CAGAATGTCA GCACGCGTAG CTAGCTAGCG
TCCAAGACGG ATTCGACGAC GAGTCGCTGA CAAAGGTGAC GTCATGCACA TGCAATGCAG GGGTGTCAGG CGAAGGGTTC
ATGGCTCGGG ACGTGACGTT CCGGAACACG GCGGGGGCGG CGAAGGGGCA GGCGGTGGCG CTGCGGGTGA GCGCGGACAT
GGCGGCGGCG TACCGGTGCG GCGTCGAGGG CCACCAGGAC TCTCTCTACG CGCACTCGTT CCGCCAGTTC TACCGCGAGT
GCGCCGTCTC CGGCACCGTC GACCTCGTCT TCGGcgacgc cgccgccgtc ctccaggcgt gcgagctcgt cgccggcgcc
cccgtcgccg gccagtccaa cgtcctcacg gcgcaggcgc gcggcgaccc caacgaggac acgggcttct ccgtgcacaa
ctgcacggtg gtcgcctcgc cggagctcct cgccagcggc gtcagcacgc gcaccttcct gggccggccg tggcggccct
acgcccgcgc cgtcgtcatg gactcctacc tcggcccgct cgtcgaccgg gccggctggg tcgagtggcc cggcgccgag
cccggccgcg ccgagACGGT GTACTTCGGT GAGTATGGGA ATGGCGGGCC GGGCGCCGCC ATGGACGGCC GCGTCGGATG
GGCCGGGTTC CATGATATGG GCTACGACGA GGCGGCCCAG TTCTCCGTCG ACAACCTCAT CTCCGGCGAC CAGTGGCTCG
CCGCCACCTC CTTCCCCTAC GACGACGACG TCTAACCGTA CGAGCATTGT CACCGACGAA ATCCATGTCC AATCAATGCA
TTGTAGTATT GCACTATTAC TACACCTGTA TTAATGAATT ATTACCACGC G