Os06t0194900-01

Locus

Os06g0194900

Description

Sucrose synthase 2 (EC 2.4.1.13).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RSUS2

CGSNL Gene Name

SUCROSE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

sus2, RSus2(t), SUS2, SS1, OsScS1, RSs1, RSus2, OsSUS2, RSS1, RSus1, OsSusy2, Susy2

Oryzabase Gene Name Synonym(s)

sucrose synthase2, Sucrose synthase 2, Sucrose synthase 1, Sucrose-UDP glucosyltransferase 2, Sucrose synthase-1, rice SuSy gene 1, sucrose-UDP glucosyltransferase isozyme 1, sucrose synthase l, rice sucrose synthase-1

Transcript Evidence

AK072074 (DDBJ, Best hit)

Protein Evidence

P30298 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: sucrose metabolic process (GO:0005985)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: sucrose synthase activity (GO:0016157)

Functional domain (InterPro)

Sucrose synthase (IPR000368)

Glycosyl transferase, family 1 (IPR001296)

Sucrose synthase, plant/cyanobacteria (IPR012820)

Full-length cDNA

J013116D04 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0194900-01)

RiceXPro (AK072074)

Others

Oryzabase (2199)

KEGG (Os06t0194900-01 (EC:2.4.1.13))

Transcript

2780 bp

>Os06t0194900-01 Sucrose synthase 2 (EC 2.4.1.13).
AACTATTTATTGGTCCTTCTGGATCTCGGAGAAACCCTCCATTCGTTTGCTCGTCTCTGA
CCACCATTGGTTCCTGAAATTGAGTCATGGCTGCCAAGCTAGCTCGCCTCCACAGTCTCC
GCGAACGCCTCGGTGCCACCTTCTCGTCTCATCCCAATGAGTTGATTGCACTCTTCTCTA
GGTATGTTAACCAGGGAAAGGGAATGCTCCAGCGTCACCAGCTGCTTGCGGAGTTCGATG
CCTTGATCGAAGCTGACAAAGAGAAATATGCTCCCTTTGAAGACATTCTCCGGGCTGCTC
AGGAAGCCATTGTGCTGCCGCCCTGGGTTGCACTGGCCATCAGGCCAAGGCCTGGTGTCT
GGGACTACATTCGGGTGAATGTAAGTGAGTTGGCAGTGGAAGAGCTGAGTGTTTCTGAGT
ACTTGGCATTCAAGGAACAGCTTGTTGATGGACACACCAACAGCAACTTTGTTCTTGAGC
TTGATTTTGAGCCCTTCAATGCCTCCTTCCCGCGCCCGTCCATGTCCAAGTCCATCGGAA
ATGGGGTGCAGTTCCTTAACCGTCACCTGTCGTCCAAGTTGTTCCAGGACAAGGAGAGCC
TCTACCCCTTGCTGAACTTCCTGAAAGCCCATAACCACAAGGGCACGACAATGATGCTGA
ATGACAGAATTCAGAGCCTTCGTGGGCTCCAATCATCCCTTAGAAAGGCAGAAGAATATC
TGATGGGCATTCCTCAAGACACGCCCTACTCGGAGTTCAACCACAGGTTCCAAGAGCTCG
GTTTGGAGAAGGGTTGGGGTGACTGTGCAAAGCGTGTGCTTGACACCATCCACTTGCTTC
TTGACCTTCTTGAGGCCCCTGATCCGGCCAACTTGGAGAAGTTCCTTGGAACTATTCCAA
TGATGTTCAATGTTGTTATCCTGTCTCCGCATGGATACTTTGCCCAATCCAATGTGTTGG
GATACCCTGATACTGGTGGTCAGgttgtgtacattttggaccaagtccgcgctttggaga
atgagatgcttttgaggatcaagcagcaaggccttgatatcacacctaagatcctcattg
taaccAGGCTGTTGCCTGATGCTGTTGGTACTACATGCGGCCAGCGTGTGGAGAAGGTTA
TTGGAACTGAGCACACTGACATTCTTCGTGTTCCATTCAGGAGTGAGAATGGTATCCTCC
GCAAGTGGATCTCCCGTTTTGATGTCTGGCCATTCCTGGAAACATACACTGAGGATGTTG
CAAACGAAATTATGAGGGAAATGCAAGCCAAACCTGATCTCATCATTGGCAATTACAGTG
ATGGAAACCTTGTTGCCACTCTGCTGGCTCACAAATTAGGAGTTACCCAGTGTACCATTG
CTCATGCCTTGGAGAAAACCAAATACCCCAACTCAGACATATACTTGGACAAGTTTGACA
GCCAGTACCACTTCTCATGCCAATTCACTGCTGATCTTATCGCCATGAATCACACTGATT
TCATCATCACCAGTACATTCCAAGAAATTGCTGGAAGCAAGGACACTGTGGGGCAGTATG
AATCACACATTGCATTCACCCTTCCTGGGCTTTACCGAGTTGTGCATGGCATAGATGTTT
TTGATCCCAAGTTCAACATTGTCTCTCCTGGAGCTGACATGAGTGTCTACTTCCCGTACA
CCGAGGCTGACAAGAGGCTCACTGCTTTCCACCCTGAAATTGAGGAGCTTCTCTACAGTG
AAGTCGAGAACGATGAACACAAGTTTGTATTGAAGGACAAGAACAAGCCAATCATCTTCT
CCATGGCTCGTCTTGACCGAGTGAAGAACATGACAGGTCTGGTTGAGATGTATGGTAAGA
ATGCACATCTCAGGGATTTGGCAAACCTTGTGATTGTTTGTGGTGACCACGGCAATCAGT
CCAAGGACAGGGAGGAGCAGGCTGAGTTCAAGAAGATGTACGGTCTCATTGACCAGTACA
AGTTGAAGGGGCATATCCGCTGGATCTCAGCTCAGATGAACCGTGTTCGTAACGGGGAGT
TGTACCGATACATTTGTGACACCAAGGGAGTCTTTGTCCAGCCTGCATTCTATGAAGCGT
TTGGTCTGACTGTCATCGAAGCCATGACATGTGGTTTGCCAACAATCGCAACATGCCATG
GTGGCCCTGCTGAGATTATTGTTGATGGGGTGTCTGGTCTGCACATTGATCCTTACCACA
GTGACAAGGCTGCTGATATCTTGGTCAACTTCTTTGAGAAGTGCAAGCAGGATTCAACCT
ACTGGGACAATATTTCACAGGGAGGTCTGCAGAGGATTTACGAGAAgtacacctggaagc
tgtactctgagaggctgatgACCTTGACTGGTGTATACGGATTCTGGAAGTACGTAAGCA
ACCTTGAGAGGCGCGAGACTCGCCGTTACATTGAGATGTTCTATGCTCTGAAATACCGCA
GCCTGGCCAGCGCCGTCCCATTGGCTGTCGATGGAGAGAGCACATCCAAGTAATGGAGGG
GAAAATATGCATCTTCAGCAGGAGAAGCCGTCAGCTGCATTCGAATTTGATAATTTTCTG
TAGTTGTCATTTGGCATCCATGTTTGCCATGGATGTGTACTATGTCTAAGGTTTCAGTAC
TTTTGCGAGATTTTGGGCAGTGCTTGCCTCAAATAAACGCCGGTTCCTGGTGTTTATCGT
TCAGAATTCAATGCAATGTTTTATTGCCGCGCTTCCTCAATCTGTCATGTTGAATGACCA
CTCCCTAGTGCCCTACTGTT

CDS

2427 bp

>Os06t0194900-01 Sucrose synthase 2 (EC 2.4.1.13).
ATGGCTGCCAAGCTAGCTCGCCTCCACAGTCTCCGCGAACGCCTCGGTGCCACCTTCTCG
TCTCATCCCAATGAGTTGATTGCACTCTTCTCTAGGTATGTTAACCAGGGAAAGGGAATG
CTCCAGCGTCACCAGCTGCTTGCGGAGTTCGATGCCTTGATCGAAGCTGACAAAGAGAAA
TATGCTCCCTTTGAAGACATTCTCCGGGCTGCTCAGGAAGCCATTGTGCTGCCGCCCTGG
GTTGCACTGGCCATCAGGCCAAGGCCTGGTGTCTGGGACTACATTCGGGTGAATGTAAGT
GAGTTGGCAGTGGAAGAGCTGAGTGTTTCTGAGTACTTGGCATTCAAGGAACAGCTTGTT
GATGGACACACCAACAGCAACTTTGTTCTTGAGCTTGATTTTGAGCCCTTCAATGCCTCC
TTCCCGCGCCCGTCCATGTCCAAGTCCATCGGAAATGGGGTGCAGTTCCTTAACCGTCAC
CTGTCGTCCAAGTTGTTCCAGGACAAGGAGAGCCTCTACCCCTTGCTGAACTTCCTGAAA
GCCCATAACCACAAGGGCACGACAATGATGCTGAATGACAGAATTCAGAGCCTTCGTGGG
CTCCAATCATCCCTTAGAAAGGCAGAAGAATATCTGATGGGCATTCCTCAAGACACGCCC
TACTCGGAGTTCAACCACAGGTTCCAAGAGCTCGGTTTGGAGAAGGGTTGGGGTGACTGT
GCAAAGCGTGTGCTTGACACCATCCACTTGCTTCTTGACCTTCTTGAGGCCCCTGATCCG
GCCAACTTGGAGAAGTTCCTTGGAACTATTCCAATGATGTTCAATGTTGTTATCCTGTCT
CCGCATGGATACTTTGCCCAATCCAATGTGTTGGGATACCCTGATACTGGTGGTCAGgtt
gtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcag
caaggccttgatatcacacctaagatcctcattgtaaccAGGCTGTTGCCTGATGCTGTT
GGTACTACATGCGGCCAGCGTGTGGAGAAGGTTATTGGAACTGAGCACACTGACATTCTT
CGTGTTCCATTCAGGAGTGAGAATGGTATCCTCCGCAAGTGGATCTCCCGTTTTGATGTC
TGGCCATTCCTGGAAACATACACTGAGGATGTTGCAAACGAAATTATGAGGGAAATGCAA
GCCAAACCTGATCTCATCATTGGCAATTACAGTGATGGAAACCTTGTTGCCACTCTGCTG
GCTCACAAATTAGGAGTTACCCAGTGTACCATTGCTCATGCCTTGGAGAAAACCAAATAC
CCCAACTCAGACATATACTTGGACAAGTTTGACAGCCAGTACCACTTCTCATGCCAATTC
ACTGCTGATCTTATCGCCATGAATCACACTGATTTCATCATCACCAGTACATTCCAAGAA
ATTGCTGGAAGCAAGGACACTGTGGGGCAGTATGAATCACACATTGCATTCACCCTTCCT
GGGCTTTACCGAGTTGTGCATGGCATAGATGTTTTTGATCCCAAGTTCAACATTGTCTCT
CCTGGAGCTGACATGAGTGTCTACTTCCCGTACACCGAGGCTGACAAGAGGCTCACTGCT
TTCCACCCTGAAATTGAGGAGCTTCTCTACAGTGAAGTCGAGAACGATGAACACAAGTTT
GTATTGAAGGACAAGAACAAGCCAATCATCTTCTCCATGGCTCGTCTTGACCGAGTGAAG
AACATGACAGGTCTGGTTGAGATGTATGGTAAGAATGCACATCTCAGGGATTTGGCAAAC
CTTGTGATTGTTTGTGGTGACCACGGCAATCAGTCCAAGGACAGGGAGGAGCAGGCTGAG
TTCAAGAAGATGTACGGTCTCATTGACCAGTACAAGTTGAAGGGGCATATCCGCTGGATC
TCAGCTCAGATGAACCGTGTTCGTAACGGGGAGTTGTACCGATACATTTGTGACACCAAG
GGAGTCTTTGTCCAGCCTGCATTCTATGAAGCGTTTGGTCTGACTGTCATCGAAGCCATG
ACATGTGGTTTGCCAACAATCGCAACATGCCATGGTGGCCCTGCTGAGATTATTGTTGAT
GGGGTGTCTGGTCTGCACATTGATCCTTACCACAGTGACAAGGCTGCTGATATCTTGGTC
AACTTCTTTGAGAAGTGCAAGCAGGATTCAACCTACTGGGACAATATTTCACAGGGAGGT
CTGCAGAGGATTTACGAGAAgtacacctggaagctgtactctgagaggctgatgACCTTG
ACTGGTGTATACGGATTCTGGAAGTACGTAAGCAACCTTGAGAGGCGCGAGACTCGCCGT
TACATTGAGATGTTCTATGCTCTGAAATACCGCAGCCTGGCCAGCGCCGTCCCATTGGCT
GTCGATGGAGAGAGCACATCCAAGTAA

Protein

809 aa

>Os06t0194900-01 Sucrose synthase 2 (EC 2.4.1.13).
MAAKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALIEADKEK
YAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLV
DGHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLK
AHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDTPYSEFNHRFQELGLEKGWGDC
AKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQV
VYILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAVGTTCGQRVEKVIGTEHTDIL
RVPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLL
AHKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQE
IAGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTA
FHPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLAN
LVIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTK
GVFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILV
NFFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRR
YIEMFYALKYRSLASAVPLAVDGESTSK*

5'UTR

chr06:4802440..4802509 (- strand) : 70 bp

chr06:4801258..4801273 (- strand) : 16 bp

CDS

chr06:4801163..4801257 (- strand) : 95 bp

chr06:4800631..4800751 (- strand) : 121 bp

chr06:4800390..4800541 (- strand) : 152 bp

chr06:4800114..4800306 (- strand) : 193 bp

chr06:4799846..4799964 (- strand) : 119 bp

chr06:4799534..4799750 (- strand) : 217 bp

chr06:4799356..4799451 (- strand) : 96 bp

chr06:4799086..4799259 (- strand) : 174 bp

chr06:4798885..4799001 (- strand) : 117 bp

chr06:4798636..4798802 (- strand) : 167 bp

chr06:4798323..4798547 (- strand) : 225 bp

chr06:4797665..4797983 (- strand) : 319 bp

chr06:4797290..4797534 (- strand) : 245 bp

chr06:4797040..4797178 (- strand) : 139 bp

chr06:4796895..4796942 (- strand) : 48 bp

3'UTR

chr06:4796628..4796894 (- strand) : 267 bp

FASTA

>Os06t0194900-01 class=Sequence position=chr06:4796628..4802509 (- strand)
AACTATTTAT TGGTCCTTCT GGATCTCGGA GAAACCCTCC ATTCGTTTGC TCGTCTCTGA CCACCATTGG GTATGTTGCT
TCCATTGCCA AACTGTTCCC TTTTACCCAT AGGCTGATTG ATCTTGGCTG TGTGATTTTT TGCTTGGGTT TTTGAGCTGA
TTCAGCGGCG CTTGCAGCCT CTTGATCGTG GTCTTGGCTC GCCCATTTCT TGCGATTCTT TGGTGGGTCG TCAGCTGAAT
CTTGCAGGAG TTTTTGCTGA CATGTTCTTG GGTTTACTGC TTTCGGTAAA TCTGAACCAA GAGGGGGGTT TCTGCTGCAG
TTTAGTGGGT TTACTATGAG CGGATTCGGG GTTTCGAGGA AAACCGGCAA AAAACCTCAA ATCCTCGACC TTTAGTTTTG
CTGCCACGTT GCTCCGCCCC ATTGCAGAGT TCTTTTTGCC CCCAAATTTT TTTTTACTTG GTGCAGTAAG AATCGCGCCT
CAGTGATTTT CTCGACTCGT AGTCCGTTGA TACTGTGTCT TGCTTATCAC TTGTTCTGCT TAATCTTTTT TGCTTCCTGA
GGAATGTCTT GGTGCCTGTC GGTGGATGGC GAACCAAAAA TGAAGGGTTT TTTTTTTTTG AACTGAGAAA AATCTTTGGG
TTTTTGGTTG GATTCTTTCA TGGAGTCGCG ACCTTCCGTA TTCTTCTCTT TGATCTCCCC GCTTGCGGAT TCATAATATT
CGGAACTTCA TGTTGGCTCT GCTTAATCTG TAGCCAAATC TTCATATCTC CAGGGATCTT TCGCTCTGTC CTATCGGATT
TAGGAATTAG GATCTAACTG GTGCTAATAC TAAAGggtaa tttggaacca tgccattata attttgcaaa gtttgagata
tgccatcggt atctcaatga TACTTACTAA AACCCAACAA ATCCATTTGA TAAAGCTGGT TCTTTTATCC CTTTGAAAAC
ATTGTCAGAG TATATTGGTT CAGGTTGATT TATTTTGAAT CAGTACTCGC ACTCTGCTTC GTAAACCATA GATGCTTTCA
GTTGTGTAGA TGAAACAGCT GTTTTTAGTT ATGTTTTGAT CTTCCAATGC TTTTGTGTGA TGTTATTAGT GTTGATTTAG
CATGGCTTTC CTGTTCAGAG ATAGTCTTGC AATGCTTAGT GATGGCTGTT GACTAATTAT TCTTGTGCAA GTGAGTGGTT
TTGGTACGTG TTGCTAAGTG TAACCTTTCT TTGCAGTTCC TGAAATTGAG TCATGGCTGC CAAGCTAGCT CGCCTCCACA
GTCTCCGCGA ACGCCTCGGT GCCACCTTCT CGTCTCATCC CAATGAGTTG ATTGCACTCT TCTCTAGGTG AAGATCTCAA
TATAATATCT TGTGTCTTCT TGGAACCTGC TACTAATTGT TTTGAGTTTT CAATGATTTT ATCCATACAG TTGGTTAGTT
CTTAGTCAAC CCAGATGTGA AACGATAACA TGTTAGTATG TTACAAATTC TTAGCTGACA AGGTTATGCA TCTCTTTAGT
TTTAATGATG GTATCTATAA TAATCTGTGA TGAGCTCTAA CATTTTTGTC TTGAGTCATG AATCTTAGAT GATGTTGAAA
TATTGTTTGT TCATAGCTAG ATTAAGTACA GATCATGTGG TCTTAAAAAT AAGAAGTAAA AATCAGGTTT ATGTGGTAGT
GCCATTAACA TAGTTCAGCC GCAGAAAGGA TGTGAGATCT AAGCATTGGT TCTATTTCTT AAATATCACT CTATGCAGGT
ATGTTAACCA GGGAAAGGGA ATGCTCCAGC GTCACCAGCT GCTTGCGGAG TTCGATGCCT TGATCGAAGC TGACAAAGAG
AAATATGCTC CCTTTGAAGA CATTCTCCGG GCTGCTCAGG TAAATTTGGC AATGAGCCAG GATGGTTATG ATAGTCAACT
CAAAGTCAAA TACCAGTCTT TCTAACTTAC TTCCTTGACT GTATGTAGGA AGCCATTGTG CTGCCGCCCT GGGTTGCACT
GGCCATCAGG CCAAGGCCTG GTGTCTGGGA CTACATTCGG GTGAATGTAA GTGAGTTGGC AGTGGAAGAG CTGAGTGTTT
CTGAGTACTT GGCATTCAAG GAACAGCTTG TTGATGGACA GTAAGTACCA GAACGACGAT TTGCAGATTA TAACTGAAGC
AAAATAACAG TGACTGAATT TTACTTCTGT TTTTCTTAAA CAGCACCAAC AGCAACTTTG TTCTTGAGCT TGATTTTGAG
CCCTTCAATG CCTCCTTCCC GCGCCCGTCC ATGTCCAAGT CCATCGGAAA TGGGGTGCAG TTCCTTAACC GTCACCTGTC
GTCCAAGTTG TTCCAGGACA AGGAGAGCCT CTACCCCTTG CTGAACTTCC TGAAAGCCCA TAACCACAAG GGCACGGTAA
GCTTCCAATT TGTGGAACAT ACCAAATGCT TTTATACTAG ATGTTTTTTC TTGTGTGAAT TGCTTTAAAT GTTAGTCCTT
TAGAAACCCA CTTGACATTC TCTGTAAGTT CCACCAAATG ACGGGATCCG AATTTTCTAT TACAGACAAT GATGCTGAAT
GACAGAATTC AGAGCCTTCG TGGGCTCCAA TCATCCCTTA GAAAGGCAGA AGAATATCTG ATGGGCATTC CTCAAGACAC
GCCCTACTCG GAGTTCAACC ACAGGTGATT ACTTTATTAT TTCTCCTTAT CATATAGCCC ATGTTATACT ACTGCAAATG
GAATAATTCC TTACAATGTG ATTCATGATT TGAATACAGG TTCCAAGAGC TCGGTTTGGA GAAGGGTTGG GGTGACTGTG
CAAAGCGTGT GCTTGACACC ATCCACTTGC TTCTTGACCT TCTTGAGGCC CCTGATCCGG CCAACTTGGA GAAGTTCCTT
GGAACTATTC CAATGATGTT CAATGTTGTT ATCCTGTCTC CGCATGGATA CTTTGCCCAA TCCAATGTGT TGGGATACCC
TGATACTGGT GGTCAGGTAG AGCTTTTTAA CAAATTTTCC CCTTATATAC AGTACTTCAA ATATTTCTAG TTTTGACCTG
TTATTCTGTT Gtttgcaggt tgtgtacatt ttggaccaag tccgcgcttt ggagaatgag atgcttttga ggatcaagca
gcaaggcctt gatatcacac ctaagatcct cattgtatgt tcaagatgtt ggtcttgaat gtttcaagtt ttaaacactt
ctcagtgcga attgtagagt aacgtgcgga catgatttta cttgatgcag gtaaccAGGC TGTTGCCTGA TGCTGTTGGT
ACTACATGCG GCCAGCGTGT GGAGAAGGTT ATTGGAACTG AGCACACTGA CATTCTTCGT GTTCCATTCA GGAGTGAGAA
TGGTATCCTC CGCAAGTGGA TCTCCCGTTT TGATGTCTGG CCATTCCTGG AAACATACAC TGAGGTAAAT GGTTTATCTG
ACAACGTCCT TCAGAGCTGA GCACAAACCA TGAATTCTGA GAGCTCATCT TTTTTTTTTT GGTTGCAGGA TGTTGCAAAC
GAAATTATGA GGGAAATGCA AGCCAAACCT GATCTCATCA TTGGCAATTA CAGTGATGGA AACCTTGTTG CCACTCTGCT
GGCTCACAAA TTAGGAGTTA CCCAGGTATG TTTGGTTGTA AACCACTCCT TTAAATATTT CTTTCATTAA GTCAATTACT
TATGATTTCT CTTCTACATG GATACAGTGT ACCATTGCTC ATGCCTTGGA GAAAACCAAA TACCCCAACT CAGACATATA
CTTGGACAAG TTTGACAGCC AGTACCACTT CTCATGCCAA TTCACTGCTG ATCTTATCGC CATGAATCAC ACTGATTTCA
TCATCACCAG TACATTCCAA GAAATTGCTG GAAGGTAAAA TTTTCTAAAG AGCAGTAGAA TATTGCTGCG TTGTGCCAAC
ACCTAAACGG GTATCTGATG TTTGTTTCCT CTGTTTCTTC AGCAAGGACA CTGTGGGGCA GTATGAATCA CACATTGCAT
TCACCCTTCC TGGGCTTTAC CGAGTTGTGC ATGGCATAGA TGTTTTTGAT CCCAAGTTCA ACATTGTCTC TCCTGGAGCT
GACATGAGTG TCTACTTCCC GTACACCGAG GCTGACAAGA GGCTCACTGC TTTCCACCCT GAAATTGAGG AGCTTCTCTA
CAGTGAAGTC GAGAACGATG AACACAAGTG AGTACTGAAC TGCTGGTTCC GTCCCTGTTA TTCACCTACC ATGTAACAAA
TAATTAAACA CTGATTTGTG TGTTTGGTCT AGCTTTGGCT CTTCAGTCTA CTAAGTGCCA TGCACTAGAA CTTTGTAGAT
TTGAACTGCA ATTCTTAATT TTCTCACTCC TTAGTAGACC ACAATAATAA TTATTGTGTC TGACCCAGCT AGTTTACAAT
AGTGACTTCA ATGCTTGTTT TTTCCCCTTG AACAATTGTT TACTTTCTAG CAGTGGAGTT TGGCATCTAA ACTTGAATAC
ACGCTGTTCT TTTTTGTGTA TAAAATGTTT ATTTAATGTT CTGCAGGTTT GTATTGAAGG ACAAGAACAA GCCAATCATC
TTCTCCATGG CTCGTCTTGA CCGAGTGAAG AACATGACAG GTCTGGTTGA GATGTATGGT AAGAATGCAC ATCTCAGGGA
TTTGGCAAAC CTTGTGATTG TTTGTGGTGA CCACGGCAAT CAGTCCAAGG ACAGGGAGGA GCAGGCTGAG TTCAAGAAGA
TGTACGGTCT CATTGACCAG TACAAGTTGA AGGGGCATAT CCGCTGGATC TCAGCTCAGA TGAACCGTGT TCGTAACGGG
GAGTTGTACC GATACATTTG TGACACCAAG GGAGTCTTTG TCCAGGTATA TACATACGCT GTCATATTCT ACTGCTATAT
TTCTATTCTG AGCTTCCAGT AGCAAATGAT TTCTACTATT TGTAAAGAAC AGCCTTGTGC TTGAGACTAA AACTGCTTTT
AAAATTGTTT TTTAGCCTGC ATTCTATGAA GCGTTTGGTC TGACTGTCAT CGAAGCCATG ACATGTGGTT TGCCAACAAT
CGCAACATGC CATGGTGGCC CTGCTGAGAT TATTGTTGAT GGGGTGTCTG GTCTGCACAT TGATCCTTAC CACAGTGACA
AGGCTGCTGA TATCTTGGTC AACTTCTTTG AGAAGTGCAA GCAGGATTCA ACCTACTGGG ACAATATTTC ACAGGGAGGT
CTGCAGAGGA TTTACGAGAA GTATGTATTT CATGATCTGC AAATATATAA CATTTTTTTT TTACGATTGA CATATAACTG
TAGAAATCAT GTGTCCAATC TATATTGATC CTACAAATTT GGActtgtca ggtacacctg gaagctgtac tctgagaggc
tgatgACCTT GACTGGTGTA TACGGATTCT GGAAGTACGT AAGCAACCTT GAGAGGCGCG AGACTCGCCG TTACATTGAG
ATGTTCTATG CTCTGAAATA CCGCAGCCTG GTAAGTTACT CTCGCTGTTC AACAGCTTGT TAATTTCAGT ATTATTGCAC
TGAGCATATC TCTGAATTCT GTTGCTACAT TTCTTTGTTG AATCCAGGCC AGCGCCGTCC CATTGGCTGT CGATGGAGAG
AGCACATCCA AGTAATGGAG GGGAAAATAT GCATCTTCAG CAGGAGAAGC CGTCAGCTGC ATTCGAATTT GATAATTTTC
TGTAGTTGTC ATTTGGCATC CATGTTTGCC ATGGATGTGT ACTATGTCTA AGGTTTCAGT ACTTTTGCGA GATTTTGGGC
AGTGCTTGCC TCAAATAAAC GCCGGTTCCT GGTGTTTATC GTTCAGAATT CAATGCAATG TTTTATTGCC GCGCTTCCTC
AATCTGTCAT GTTGAATGAC CACTCCCTAG TGCCCTACTG TT

Locus: Os06g0194900

Loading...

Locus: Os06g0194900

Loading...