Os06t0194900-02

Locus

Os06g0194900

Description

Sucrose synthase 2 (EC 2.4.1.13).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RSUS2

CGSNL Gene Name

SUCROSE SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

sus2, RSus2(t), SUS2, SS1, OsScS1, RSs1, RSus2, OsSUS2, RSS1, RSus1, OsSusy2, Susy2

Oryzabase Gene Name Synonym(s)

sucrose synthase2, Sucrose synthase 2, Sucrose synthase 1, Sucrose-UDP glucosyltransferase 2, Sucrose synthase-1, rice SuSy gene 1, sucrose-UDP glucosyltransferase isozyme 1, sucrose synthase l, rice sucrose synthase-1

Transcript Evidence

AK098923 (DDBJ, Best hit)

Protein Evidence

P30298 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: sucrose metabolic process (GO:0005985)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: sucrose synthase activity (GO:0016157)

Functional domain (InterPro)

Sucrose synthase (IPR000368)

Glycosyl transferase, family 1 (IPR001296)

Sucrose synthase, plant/cyanobacteria (IPR012820)

Full-length cDNA

J013002P14 (Online Clone Ordering)

Expression Databases

TENOR (Os06t0194900-02)

RiceXPro (AK098923)

Others

Oryzabase (2199)

KEGG (Os06t0194900-02 (EC:2.4.1.13))

Transcript

2701 bp

>Os06t0194900-02 Sucrose synthase 2 (EC 2.4.1.13).
TCCATTCGTTTGCTCGTCTCTGACCACCATTGGTTCCTGAAATTGAGTCATGGCTGCCAA
GCTAGCTCGCCTCCACAGTCTCCGCGAACGCCTCGGTGCCACCTTCTCGTCTCATCCCAA
TGAGTTGATTGCACTCTTCTCTAGGTATGTTAACCAGGGAAAGGGAATGCTCCAGCGTCA
CCAGCTGCTTGCGGAGTTCGATGCCTTGATCGAAGCTGACAAAGAGAAATATGCTCCCTT
TGAAGACATTCTCCGGGCTGCTCAGGAAGCCATTGTGCTGCCGCCCTGGGTTGCACTGGC
CATCAGGCCAAGGCCTGGTGTCTGGGACTACATTCGGGTGAATGTAAGTGAGTTGGCAGT
GGAAGAGCTGAGTGTTTCTGAGTACTTGGCATTCAAGGAACAGCTTGTTGATGGACACAC
CAACAGCAACTTTGTTCTTGAGCTTGATTTTGAGCCCTTCAATGCCTCCTTCCCGCGCCC
GTCCATGTCCAAGTCCATCGGAAATGGGGTGCAGTTCCTTAACCGTCACCTGTCGTCCAA
GTTGTTCCAGGACAAGGAGAGCCTCTACCCCTTGCTGAACTTCCTGAAAGCCCATAACCA
CAAGGGCACGACAATGATGCTGAATGACAGAATTCAGAGCCTTCGTGGGCTCCAATCATC
CCTTAGAAAGGCAGAAGAATATCTGATGGGCATTCCTCAAGACACGCCCTACTCGGAGTT
CAACCACAGGTTCCAAGAGCTCGGTTTGGAGAAGGGTTGGGGTGACTGTGCAAAGCGTGT
GCTTGACACCATCCACTTGCTTCTTGACCTTCTTGAGGCCCCTGATCCGGCCAACTTGGA
GAAGTTCCTTGGAACTATTCCAATGATGTTCAATGTTGTTATCCTGTCTCCGCATGGATA
CTTTGCCCAATCCAATGTGTTGGGATACCCTGATACTGGTGGTCAGgttgtgtacatttt
ggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcagcaaggccttga
tatcacacctaagatcctcattgtaaccAGGCTGTTGCCTGATGCTGTTGGTACTACATG
CGGCCAGCGTGTGGAGAAGGTTATTGGAACTGAGCACACTGACATTCTTCGTGTTCCATT
CAGGAGTGAGAATGGTATCCTCCGCAAGTGGATCTCCCGTTTTGATGTCTGGCCATTCCT
GGAAACATACACTGAGGATGTTGCAAACGAAATTATGAGGGAAATGCAAGCCAAACCTGA
TCTCATCATTGGCAATTACAGTGATGGAAACCTTGTTGCCACTCTGCTGGCTCACAAATT
AGGAGTTACCCAGTGTACCATTGCTCATGCCTTGGAGAAAACCAAATACCCCAACTCAGA
CATATACTTGGACAAGTTTGACAGCCAGTACCACTTCTCATGCCAATTCACTGCTGATCT
TATCGCCATGAATCACACTGATTTCATCATCACCAGTACATTCCAAGAAATTGCTGGAAG
CAAGGACACTGTGGGGCAGTATGAATCACACATTGCATTCACCCTTCCTGGGCTTTACCG
AGTTGTGCATGGCATAGATGTTTTTGATCCCAAGTTCAACATTGTCTCTCCTGGAGCTGA
CATGAGTGTCTACTTCCCGTACACCGAGGCTGACAAGAGGCTCACTGCTTTCCACCCTGA
AATTGAGGAGCTTCTCTACAGTGAAGTCGAGAACGATGAACACAAGTTTGTATTGAAGGA
CAAGAACAAGCCAATCATCTTCTCCATGGCTCGTCTTGACCGAGTGAAGAACATGACAGG
TCTGGTTGAGATGTATGGTAAGAATGCACATCTCAGGGATTTGGCAAACCTTGTGATTGT
TTGTGGTGACCACGGCAATCAGTCCAAGGACAGGGAGGAGCAGGCTGAGTTCAAGAAGAT
GTACGGTCTCATTGACCAGTACAAGTTGAAGGGGCATATCCGCTGGATCTCAGCTCAGAT
GAACCGTGTTCGTAACGGGGAGTTGTACCGATACATTTGTGACACCAAGGGAGTCTTTGT
CCAGCCTGCATTCTATGAAGCGTTTGGTCTGACTGTCATCGAAGCCATGACATGTGGTTT
GCCAACAATCGCAACATGCCATGGTGGCCCTGCTGAGATTATTGTTGATGGGGTGTCTGG
TCTGCACATTGATCCTTACCACAGTGACAAGGCTGCTGATATCTTGGTCAACTTCTTTGA
GAAGTGCAAGCAGGATTCAACCTACTGGGACAATATTTCACAGGGAGGTCTGCAGAGGAT
TTACGAGAAgtacacctggaagctgtactctgagaggctgatgACCTTGACTGGTGTATA
CGGATTCTGGAAGTACGTAAGCAACCTTGAGAGGCGCGAGACTCGCCGTTACATTGAGAT
GTTCTATGCTCTGAAATACCGCAGCCTGGCCAGCGCCGTCCCATTGGCTGTCGATGGAGA
GAGCACATCCAAGTAATGGAGGGGAAAATATGCATCTTCAGCAGGAGAAGCCGTCAGCTG
CATTCGAATTTGATAATTTTCTGTAGTTGTCATTTGGCATCCATGTTTGCCATGGATGTG
TACTATGTCTAAGGTTTCAGTACTTTTGCGAGATTTTGGGCAGTGCTTGCCTCAAATAAA
CGCCGGTTCCTGGTGTTTATCGTTCAGAATTCAATGCAATGTTTTATTGCCGCGCTTCCT
C

CDS

2427 bp

>Os06t0194900-02 Sucrose synthase 2 (EC 2.4.1.13).
ATGGCTGCCAAGCTAGCTCGCCTCCACAGTCTCCGCGAACGCCTCGGTGCCACCTTCTCG
TCTCATCCCAATGAGTTGATTGCACTCTTCTCTAGGTATGTTAACCAGGGAAAGGGAATG
CTCCAGCGTCACCAGCTGCTTGCGGAGTTCGATGCCTTGATCGAAGCTGACAAAGAGAAA
TATGCTCCCTTTGAAGACATTCTCCGGGCTGCTCAGGAAGCCATTGTGCTGCCGCCCTGG
GTTGCACTGGCCATCAGGCCAAGGCCTGGTGTCTGGGACTACATTCGGGTGAATGTAAGT
GAGTTGGCAGTGGAAGAGCTGAGTGTTTCTGAGTACTTGGCATTCAAGGAACAGCTTGTT
GATGGACACACCAACAGCAACTTTGTTCTTGAGCTTGATTTTGAGCCCTTCAATGCCTCC
TTCCCGCGCCCGTCCATGTCCAAGTCCATCGGAAATGGGGTGCAGTTCCTTAACCGTCAC
CTGTCGTCCAAGTTGTTCCAGGACAAGGAGAGCCTCTACCCCTTGCTGAACTTCCTGAAA
GCCCATAACCACAAGGGCACGACAATGATGCTGAATGACAGAATTCAGAGCCTTCGTGGG
CTCCAATCATCCCTTAGAAAGGCAGAAGAATATCTGATGGGCATTCCTCAAGACACGCCC
TACTCGGAGTTCAACCACAGGTTCCAAGAGCTCGGTTTGGAGAAGGGTTGGGGTGACTGT
GCAAAGCGTGTGCTTGACACCATCCACTTGCTTCTTGACCTTCTTGAGGCCCCTGATCCG
GCCAACTTGGAGAAGTTCCTTGGAACTATTCCAATGATGTTCAATGTTGTTATCCTGTCT
CCGCATGGATACTTTGCCCAATCCAATGTGTTGGGATACCCTGATACTGGTGGTCAGgtt
gtgtacattttggaccaagtccgcgctttggagaatgagatgcttttgaggatcaagcag
caaggccttgatatcacacctaagatcctcattgtaaccAGGCTGTTGCCTGATGCTGTT
GGTACTACATGCGGCCAGCGTGTGGAGAAGGTTATTGGAACTGAGCACACTGACATTCTT
CGTGTTCCATTCAGGAGTGAGAATGGTATCCTCCGCAAGTGGATCTCCCGTTTTGATGTC
TGGCCATTCCTGGAAACATACACTGAGGATGTTGCAAACGAAATTATGAGGGAAATGCAA
GCCAAACCTGATCTCATCATTGGCAATTACAGTGATGGAAACCTTGTTGCCACTCTGCTG
GCTCACAAATTAGGAGTTACCCAGTGTACCATTGCTCATGCCTTGGAGAAAACCAAATAC
CCCAACTCAGACATATACTTGGACAAGTTTGACAGCCAGTACCACTTCTCATGCCAATTC
ACTGCTGATCTTATCGCCATGAATCACACTGATTTCATCATCACCAGTACATTCCAAGAA
ATTGCTGGAAGCAAGGACACTGTGGGGCAGTATGAATCACACATTGCATTCACCCTTCCT
GGGCTTTACCGAGTTGTGCATGGCATAGATGTTTTTGATCCCAAGTTCAACATTGTCTCT
CCTGGAGCTGACATGAGTGTCTACTTCCCGTACACCGAGGCTGACAAGAGGCTCACTGCT
TTCCACCCTGAAATTGAGGAGCTTCTCTACAGTGAAGTCGAGAACGATGAACACAAGTTT
GTATTGAAGGACAAGAACAAGCCAATCATCTTCTCCATGGCTCGTCTTGACCGAGTGAAG
AACATGACAGGTCTGGTTGAGATGTATGGTAAGAATGCACATCTCAGGGATTTGGCAAAC
CTTGTGATTGTTTGTGGTGACCACGGCAATCAGTCCAAGGACAGGGAGGAGCAGGCTGAG
TTCAAGAAGATGTACGGTCTCATTGACCAGTACAAGTTGAAGGGGCATATCCGCTGGATC
TCAGCTCAGATGAACCGTGTTCGTAACGGGGAGTTGTACCGATACATTTGTGACACCAAG
GGAGTCTTTGTCCAGCCTGCATTCTATGAAGCGTTTGGTCTGACTGTCATCGAAGCCATG
ACATGTGGTTTGCCAACAATCGCAACATGCCATGGTGGCCCTGCTGAGATTATTGTTGAT
GGGGTGTCTGGTCTGCACATTGATCCTTACCACAGTGACAAGGCTGCTGATATCTTGGTC
AACTTCTTTGAGAAGTGCAAGCAGGATTCAACCTACTGGGACAATATTTCACAGGGAGGT
CTGCAGAGGATTTACGAGAAgtacacctggaagctgtactctgagaggctgatgACCTTG
ACTGGTGTATACGGATTCTGGAAGTACGTAAGCAACCTTGAGAGGCGCGAGACTCGCCGT
TACATTGAGATGTTCTATGCTCTGAAATACCGCAGCCTGGCCAGCGCCGTCCCATTGGCT
GTCGATGGAGAGAGCACATCCAAGTAA

Protein

809 aa

>Os06t0194900-02 Sucrose synthase 2 (EC 2.4.1.13).
MAAKLARLHSLRERLGATFSSHPNELIALFSRYVNQGKGMLQRHQLLAEFDALIEADKEK
YAPFEDILRAAQEAIVLPPWVALAIRPRPGVWDYIRVNVSELAVEELSVSEYLAFKEQLV
DGHTNSNFVLELDFEPFNASFPRPSMSKSIGNGVQFLNRHLSSKLFQDKESLYPLLNFLK
AHNHKGTTMMLNDRIQSLRGLQSSLRKAEEYLMGIPQDTPYSEFNHRFQELGLEKGWGDC
AKRVLDTIHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQV
VYILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAVGTTCGQRVEKVIGTEHTDIL
RVPFRSENGILRKWISRFDVWPFLETYTEDVANEIMREMQAKPDLIIGNYSDGNLVATLL
AHKLGVTQCTIAHALEKTKYPNSDIYLDKFDSQYHFSCQFTADLIAMNHTDFIITSTFQE
IAGSKDTVGQYESHIAFTLPGLYRVVHGIDVFDPKFNIVSPGADMSVYFPYTEADKRLTA
FHPEIEELLYSEVENDEHKFVLKDKNKPIIFSMARLDRVKNMTGLVEMYGKNAHLRDLAN
LVIVCGDHGNQSKDREEQAEFKKMYGLIDQYKLKGHIRWISAQMNRVRNGELYRYICDTK
GVFVQPAFYEAFGLTVIEAMTCGLPTIATCHGGPAEIIVDGVSGLHIDPYHSDKAADILV
NFFEKCKQDSTYWDNISQGGLQRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRR
YIEMFYALKYRSLASAVPLAVDGESTSK*

5'UTR

chr06:4802440..4802472 (- strand) : 33 bp

chr06:4801258..4801273 (- strand) : 16 bp

CDS

chr06:4801163..4801257 (- strand) : 95 bp

chr06:4800631..4800751 (- strand) : 121 bp

chr06:4800390..4800541 (- strand) : 152 bp

chr06:4800114..4800306 (- strand) : 193 bp

chr06:4799846..4799964 (- strand) : 119 bp

chr06:4799534..4799750 (- strand) : 217 bp

chr06:4799356..4799451 (- strand) : 96 bp

chr06:4799086..4799259 (- strand) : 174 bp

chr06:4798885..4799001 (- strand) : 117 bp

chr06:4798636..4798802 (- strand) : 167 bp

chr06:4798323..4798547 (- strand) : 225 bp

chr06:4797665..4797983 (- strand) : 319 bp

chr06:4797290..4797534 (- strand) : 245 bp

chr06:4797040..4797178 (- strand) : 139 bp

chr06:4796895..4796942 (- strand) : 48 bp

3'UTR

chr06:4796670..4796894 (- strand) : 225 bp

FASTA

>Os06t0194900-02 class=Sequence position=chr06:4796670..4802472 (- strand)
TCCATTCGTT TGCTCGTCTC TGACCACCAT TGGGTATGTT GCTTCCATTG CCAAACTGTT CCCTTTTACC CATAGGCTGA
TTGATCTTGG CTGTGTGATT TTTTGCTTGG GTTTTTGAGC TGATTCAGCG GCGCTTGCAG CCTCTTGATC GTGGTCTTGG
CTCGCCCATT TCTTGCGATT CTTTGGTGGG TCGTCAGCTG AATCTTGCAG GAGTTTTTGC TGACATGTTC TTGGGTTTAC
TGCTTTCGGT AAATCTGAAC CAAGAGGGGG GTTTCTGCTG CAGTTTAGTG GGTTTACTAT GAGCGGATTC GGGGTTTCGA
GGAAAACCGG CAAAAAACCT CAAATCCTCG ACCTTTAGTT TTGCTGCCAC GTTGCTCCGC CCCATTGCAG AGTTCTTTTT
GCCCCCAAAT TTTTTTTTAC TTGGTGCAGT AAGAATCGCG CCTCAGTGAT TTTCTCGACT CGTAGTCCGT TGATACTGTG
TCTTGCTTAT CACTTGTTCT GCTTAATCTT TTTTGCTTCC TGAGGAATGT CTTGGTGCCT GTCGGTGGAT GGCGAACCAA
AAATGAAGGG TTTTTTTTTT TTGAACTGAG AAAAATCTTT GGGTTTTTGG TTGGATTCTT TCATGGAGTC GCGACCTTCC
GTATTCTTCT CTTTGATCTC CCCGCTTGCG GATTCATAAT ATTCGGAACT TCATGTTGGC TCTGCTTAAT CTGTAGCCAA
ATCTTCATAT CTCCAGGGAT CTTTCGCTCT GTCCTATCGG ATTTAGGAAT TAGGATCTAA CTGGTGCTAA TACTAAAGgg
taatttggaa ccatgccatt ataattttgc aaagtttgag atatgccatc ggtatctcaa tgaTACTTAC TAAAACCCAA
CAAATCCATT TGATAAAGCT GGTTCTTTTA TCCCTTTGAA AACATTGTCA GAGTATATTG GTTCAGGTTG ATTTATTTTG
AATCAGTACT CGCACTCTGC TTCGTAAACC ATAGATGCTT TCAGTTGTGT AGATGAAACA GCTGTTTTTA GTTATGTTTT
GATCTTCCAA TGCTTTTGTG TGATGTTATT AGTGTTGATT TAGCATGGCT TTCCTGTTCA GAGATAGTCT TGCAATGCTT
AGTGATGGCT GTTGACTAAT TATTCTTGTG CAAGTGAGTG GTTTTGGTAC GTGTTGCTAA GTGTAACCTT TCTTTGCAGT
TCCTGAAATT GAGTCATGGC TGCCAAGCTA GCTCGCCTCC ACAGTCTCCG CGAACGCCTC GGTGCCACCT TCTCGTCTCA
TCCCAATGAG TTGATTGCAC TCTTCTCTAG GTGAAGATCT CAATATAATA TCTTGTGTCT TCTTGGAACC TGCTACTAAT
TGTTTTGAGT TTTCAATGAT TTTATCCATA CAGTTGGTTA GTTCTTAGTC AACCCAGATG TGAAACGATA ACATGTTAGT
ATGTTACAAA TTCTTAGCTG ACAAGGTTAT GCATCTCTTT AGTTTTAATG ATGGTATCTA TAATAATCTG TGATGAGCTC
TAACATTTTT GTCTTGAGTC ATGAATCTTA GATGATGTTG AAATATTGTT TGTTCATAGC TAGATTAAGT ACAGATCATG
TGGTCTTAAA AATAAGAAGT AAAAATCAGG TTTATGTGGT AGTGCCATTA ACATAGTTCA GCCGCAGAAA GGATGTGAGA
TCTAAGCATT GGTTCTATTT CTTAAATATC ACTCTATGCA GGTATGTTAA CCAGGGAAAG GGAATGCTCC AGCGTCACCA
GCTGCTTGCG GAGTTCGATG CCTTGATCGA AGCTGACAAA GAGAAATATG CTCCCTTTGA AGACATTCTC CGGGCTGCTC
AGGTAAATTT GGCAATGAGC CAGGATGGTT ATGATAGTCA ACTCAAAGTC AAATACCAGT CTTTCTAACT TACTTCCTTG
ACTGTATGTA GGAAGCCATT GTGCTGCCGC CCTGGGTTGC ACTGGCCATC AGGCCAAGGC CTGGTGTCTG GGACTACATT
CGGGTGAATG TAAGTGAGTT GGCAGTGGAA GAGCTGAGTG TTTCTGAGTA CTTGGCATTC AAGGAACAGC TTGTTGATGG
ACAGTAAGTA CCAGAACGAC GATTTGCAGA TTATAACTGA AGCAAAATAA CAGTGACTGA ATTTTACTTC TGTTTTTCTT
AAACAGCACC AACAGCAACT TTGTTCTTGA GCTTGATTTT GAGCCCTTCA ATGCCTCCTT CCCGCGCCCG TCCATGTCCA
AGTCCATCGG AAATGGGGTG CAGTTCCTTA ACCGTCACCT GTCGTCCAAG TTGTTCCAGG ACAAGGAGAG CCTCTACCCC
TTGCTGAACT TCCTGAAAGC CCATAACCAC AAGGGCACGG TAAGCTTCCA ATTTGTGGAA CATACCAAAT GCTTTTATAC
TAGATGTTTT TTCTTGTGTG AATTGCTTTA AATGTTAGTC CTTTAGAAAC CCACTTGACA TTCTCTGTAA GTTCCACCAA
ATGACGGGAT CCGAATTTTC TATTACAGAC AATGATGCTG AATGACAGAA TTCAGAGCCT TCGTGGGCTC CAATCATCCC
TTAGAAAGGC AGAAGAATAT CTGATGGGCA TTCCTCAAGA CACGCCCTAC TCGGAGTTCA ACCACAGGTG ATTACTTTAT
TATTTCTCCT TATCATATAG CCCATGTTAT ACTACTGCAA ATGGAATAAT TCCTTACAAT GTGATTCATG ATTTGAATAC
AGGTTCCAAG AGCTCGGTTT GGAGAAGGGT TGGGGTGACT GTGCAAAGCG TGTGCTTGAC ACCATCCACT TGCTTCTTGA
CCTTCTTGAG GCCCCTGATC CGGCCAACTT GGAGAAGTTC CTTGGAACTA TTCCAATGAT GTTCAATGTT GTTATCCTGT
CTCCGCATGG ATACTTTGCC CAATCCAATG TGTTGGGATA CCCTGATACT GGTGGTCAGG TAGAGCTTTT TAACAAATTT
TCCCCTTATA TACAGTACTT CAAATATTTC TAGTTTTGAC CTGTTATTCT GTTGtttgca ggttgtgtac attttggacc
aagtccgcgc tttggagaat gagatgcttt tgaggatcaa gcagcaaggc cttgatatca cacctaagat cctcattgta
tgttcaagat gttggtcttg aatgtttcaa gttttaaaca cttctcagtg cgaattgtag agtaacgtgc ggacatgatt
ttacttgatg caggtaaccA GGCTGTTGCC TGATGCTGTT GGTACTACAT GCGGCCAGCG TGTGGAGAAG GTTATTGGAA
CTGAGCACAC TGACATTCTT CGTGTTCCAT TCAGGAGTGA GAATGGTATC CTCCGCAAGT GGATCTCCCG TTTTGATGTC
TGGCCATTCC TGGAAACATA CACTGAGGTA AATGGTTTAT CTGACAACGT CCTTCAGAGC TGAGCACAAA CCATGAATTC
TGAGAGCTCA TCTTTTTTTT TTTGGTTGCA GGATGTTGCA AACGAAATTA TGAGGGAAAT GCAAGCCAAA CCTGATCTCA
TCATTGGCAA TTACAGTGAT GGAAACCTTG TTGCCACTCT GCTGGCTCAC AAATTAGGAG TTACCCAGGT ATGTTTGGTT
GTAAACCACT CCTTTAAATA TTTCTTTCAT TAAGTCAATT ACTTATGATT TCTCTTCTAC ATGGATACAG TGTACCATTG
CTCATGCCTT GGAGAAAACC AAATACCCCA ACTCAGACAT ATACTTGGAC AAGTTTGACA GCCAGTACCA CTTCTCATGC
CAATTCACTG CTGATCTTAT CGCCATGAAT CACACTGATT TCATCATCAC CAGTACATTC CAAGAAATTG CTGGAAGGTA
AAATTTTCTA AAGAGCAGTA GAATATTGCT GCGTTGTGCC AACACCTAAA CGGGTATCTG ATGTTTGTTT CCTCTGTTTC
TTCAGCAAGG ACACTGTGGG GCAGTATGAA TCACACATTG CATTCACCCT TCCTGGGCTT TACCGAGTTG TGCATGGCAT
AGATGTTTTT GATCCCAAGT TCAACATTGT CTCTCCTGGA GCTGACATGA GTGTCTACTT CCCGTACACC GAGGCTGACA
AGAGGCTCAC TGCTTTCCAC CCTGAAATTG AGGAGCTTCT CTACAGTGAA GTCGAGAACG ATGAACACAA GTGAGTACTG
AACTGCTGGT TCCGTCCCTG TTATTCACCT ACCATGTAAC AAATAATTAA ACACTGATTT GTGTGTTTGG TCTAGCTTTG
GCTCTTCAGT CTACTAAGTG CCATGCACTA GAACTTTGTA GATTTGAACT GCAATTCTTA ATTTTCTCAC TCCTTAGTAG
ACCACAATAA TAATTATTGT GTCTGACCCA GCTAGTTTAC AATAGTGACT TCAATGCTTG TTTTTTCCCC TTGAACAATT
GTTTACTTTC TAGCAGTGGA GTTTGGCATC TAAACTTGAA TACACGCTGT TCTTTTTTGT GTATAAAATG TTTATTTAAT
GTTCTGCAGG TTTGTATTGA AGGACAAGAA CAAGCCAATC ATCTTCTCCA TGGCTCGTCT TGACCGAGTG AAGAACATGA
CAGGTCTGGT TGAGATGTAT GGTAAGAATG CACATCTCAG GGATTTGGCA AACCTTGTGA TTGTTTGTGG TGACCACGGC
AATCAGTCCA AGGACAGGGA GGAGCAGGCT GAGTTCAAGA AGATGTACGG TCTCATTGAC CAGTACAAGT TGAAGGGGCA
TATCCGCTGG ATCTCAGCTC AGATGAACCG TGTTCGTAAC GGGGAGTTGT ACCGATACAT TTGTGACACC AAGGGAGTCT
TTGTCCAGGT ATATACATAC GCTGTCATAT TCTACTGCTA TATTTCTATT CTGAGCTTCC AGTAGCAAAT GATTTCTACT
ATTTGTAAAG AACAGCCTTG TGCTTGAGAC TAAAACTGCT TTTAAAATTG TTTTTTAGCC TGCATTCTAT GAAGCGTTTG
GTCTGACTGT CATCGAAGCC ATGACATGTG GTTTGCCAAC AATCGCAACA TGCCATGGTG GCCCTGCTGA GATTATTGTT
GATGGGGTGT CTGGTCTGCA CATTGATCCT TACCACAGTG ACAAGGCTGC TGATATCTTG GTCAACTTCT TTGAGAAGTG
CAAGCAGGAT TCAACCTACT GGGACAATAT TTCACAGGGA GGTCTGCAGA GGATTTACGA GAAGTATGTA TTTCATGATC
TGCAAATATA TAACATTTTT TTTTTACGAT TGACATATAA CTGTAGAAAT CATGTGTCCA ATCTATATTG ATCCTACAAA
TTTGGActtg tcaggtacac ctggaagctg tactctgaga ggctgatgAC CTTGACTGGT GTATACGGAT TCTGGAAGTA
CGTAAGCAAC CTTGAGAGGC GCGAGACTCG CCGTTACATT GAGATGTTCT ATGCTCTGAA ATACCGCAGC CTGGTAAGTT
ACTCTCGCTG TTCAACAGCT TGTTAATTTC AGTATTATTG CACTGAGCAT ATCTCTGAAT TCTGTTGCTA CATTTCTTTG
TTGAATCCAG GCCAGCGCCG TCCCATTGGC TGTCGATGGA GAGAGCACAT CCAAGTAATG GAGGGGAAAA TATGCATCTT
CAGCAGGAGA AGCCGTCAGC TGCATTCGAA TTTGATAATT TTCTGTAGTT GTCATTTGGC ATCCATGTTT GCCATGGATG
TGTACTATGT CTAAGGTTTC AGTACTTTTG CGAGATTTTG GGCAGTGCTT GCCTCAAATA AACGCCGGTT CCTGGTGTTT
ATCGTTCAGA ATTCAATGCA ATGTTTTATT GCCGCGCTTC CTC

Locus: Os06g0194900

Loading...

Locus: Os06g0194900

Loading...